KEGG   Streptococcus suis TL13 (serotype 16): TL13_0385Help
Entry
TL13_0385         CDS       T02672                                 

Gene name
aspC
Definition
(GenBank) Aspartate aminotransferase
  KO
K14260  alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
ssut  Streptococcus suis TL13 (serotype 16)
Pathway
ssut00220  Arginine biosynthesis
ssut00250  Alanine, aspartate and glutamate metabolism
ssut00290  Valine, leucine and isoleucine biosynthesis
ssut01100  Metabolic pathways
ssut01110  Biosynthesis of secondary metabolites
ssut01130  Biosynthesis of antibiotics
ssut01210  2-Oxocarboxylic acid metabolism
ssut01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ssut00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    TL13_0385 (aspC)
   00290 Valine, leucine and isoleucine biosynthesis
    TL13_0385 (aspC)
   00220 Arginine biosynthesis
    TL13_0385 (aspC)
Enzymes [BR:ssut01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     TL13_0385 (aspC)
    2.6.1.66  valine---pyruvate transaminase
     TL13_0385 (aspC)
Amino acid related enzymes [BR:ssut01007]
 Aminotransferase (transaminase)
  Class I
   TL13_0385 (aspC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 DegT_DnrJ_EryC1 Aminotran_5
Motif
Other DBs
NCBI-ProteinID: AGL47329
Position
380447..381661
Genome map
AA seq 404 aa AA seqDB search
MKQFNKSTKLDDVAYDIRGPVLEEAMRMRANGEQILRLNTGNPAEFGFTAPDEVIRDLIH
NARKSEGYSNSKGIFSARKAIMQYCQLKKFPNVDIEDIYLGNGVSELIVMSMQGLLDNGD
EVLVPMPDYPLWTAAVSLAGGKAVHYVCDEAAEWYPDLADMESKVTSRTKAIVLINPNNP
TGALYPKEILEGIIDIARRHELIIFSDEIYDRMVFDGAVHIPIATLAPDLFVVTMNGLSK
SHRICGFRVGWMVLSGPKKHVKGYIEGLNMLSNMRLCSNVLAQQVVQTSLGGYQSVDELL
MPGGRLYEQREFITKAINDIPGLSAVKPKAGLYVFPKIDREMYRVEDDEQFVLDFLKQEK
VLLVHGRGFNWKDPDHFRIVYLPRVDELAEIQEKMSRFLRQYRR
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgaagcaatttaacaagtcaacaaaattggatgatgtagcatatgatattcgtgggcct
gttttggaagaggccatgcgcatgcgtgccaatggagagcagattttacgtttgaatacg
gggaatcctgcagaatttggttttactgctccagatgaagttattcgtgacttgattcat
aacgcccgtaaatcagagggatattcgaacagtaagggaattttttctgcacgtaaggct
atcatgcagtattgtcagctaaagaaatttccaaatgttgatattgaagatatttatctt
ggaaacggcgtgagtgagctgattgttatgtctatgcaaggtttgctagataatggtgat
gaggtattggtgccaatgccagactatcctctctggactgccgcagttagtttggctggt
ggtaaagctgttcactatgtttgtgatgaagcagctgaatggtatccagatttggcagat
atggagtccaaggtgacttctcgaaccaaggcaattgtccttatcaatccaaataatcca
actggtgctctctatccgaaagaaattttagaaggaatcattgatattgctcgtagacat
gaattgatcattttctctgatgagatttatgatcgtatggtctttgacggagctgttcat
atccctattgcgaccctggctccagatttatttgttgtgacgatgaatggactgtctaaa
tcgcatcgtatttgtggtttccgagtaggttggatggtcttatctggtccgaaaaagcat
gtaaaaggttacattgaaggcttgaatatgttgtccaatatgcgtttgtgttcaaacgtt
ttggctcaacaggttgttcaaacttctttgggaggttaccaatcggttgatgaactcttg
atgcctggcggacgcttatatgaacaaagggagttcattaccaaggcgattaatgatatt
ccgggactttctgctgtaaaacctaaggctggtctgtatgtcttccccaaaattgatcgt
gagatgtaccgagttgaggatgatgaacaatttgtattggatttcctcaagcaagaaaaa
gtacttttggtccatggtcgaggttttaactggaaggatccagatcatttccgtattgtg
tatttaccacgtgtggatgagttggcagaaattcaagaaaaaatgtcacgattcttgcgg
caatatcgtagataa

DBGET integrated database retrieval system