KEGG   Streptococcus suis TL13 (serotype 16): TL13_1136Help
Entry
TL13_1136         CDS       T02672                                 

Gene name
dltC
Definition
(GenBank) D-alanine--poly(phosphoribitol) ligase subunit 2
  KO
K14188  D-alanine--poly(phosphoribitol) ligase subunit 2 [EC:6.1.1.13]
Organism
ssut  Streptococcus suis TL13 (serotype 16)
Pathway
ssut00473  D-Alanine metabolism
ssut01100  Metabolic pathways
ssut01503  Cationic antimicrobial peptide (CAMP) resistance
ssut02020  Two-component system
Brite
KEGG Orthology (KO) [BR:ssut00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    TL13_1136 (dltC)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    TL13_1136 (dltC)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01503 Cationic antimicrobial peptide (CAMP) resistance
    TL13_1136 (dltC)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   01504 Antimicrobial resistance genes [BR:ssut01504]
    TL13_1136 (dltC)
Enzymes [BR:ssut01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.13  D-alanine---poly(phosphoribitol) ligase
     TL13_1136 (dltC)
Antimicrobial resistance genes [BR:ssut01504]
 Gene sets
  CAMP resistance modules
   Cationic antimicrobial peptide (CAMP) resistance, dltABCD operon [MD:M00725]
    TL13_1136 (dltC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PP-binding Ribosomal_L12_N
Motif
Other DBs
NCBI-ProteinID: AGL48063
Position
complement(1159649..1159888)
Genome map
AA seq 79 aa AA seqDB search
MDVKETILNIIEELFMEDVSEMMDEDLFDAGVLDSMGTVELIVELESRFNITVPVSEFGR
EDWNTANKIISGVVELMHA
NT seq 240 nt NT seq  +upstreamnt  +downstreamnt
atggatgtaaaagaaacaatattgaatattatcgaagaattatttatggaagatgtatct
gaaatgatggatgaagacctatttgatgcgggtgttttggatagtatggggaccgtagaa
cttattgtggagttagaaagtcgttttaatattacagttccagtttcagagtttggtcgt
gaagattggaatacagctaacaaaatcatttctggtgttgtggagttgatgcatgcgtaa

DBGET integrated database retrieval system