KEGG   Streptococcus suis TL13 (serotype 16): TL13_1439Help
Entry
TL13_1439         CDS       T02672                                 

Gene name
atoB
Definition
(GenBank) Acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
ssut  Streptococcus suis TL13 (serotype 16)
Pathway
ssut00071  Fatty acid degradation
ssut00072  Synthesis and degradation of ketone bodies
ssut00280  Valine, leucine and isoleucine degradation
ssut00310  Lysine degradation
ssut00362  Benzoate degradation
ssut00380  Tryptophan metabolism
ssut00620  Pyruvate metabolism
ssut00630  Glyoxylate and dicarboxylate metabolism
ssut00640  Propanoate metabolism
ssut00650  Butanoate metabolism
ssut00900  Terpenoid backbone biosynthesis
ssut01100  Metabolic pathways
ssut01110  Biosynthesis of secondary metabolites
ssut01120  Microbial metabolism in diverse environments
ssut01130  Biosynthesis of antibiotics
ssut01200  Carbon metabolism
ssut01212  Fatty acid metabolism
ssut02020  Two-component system
Brite
KEGG Orthology (KO) [BR:ssut00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    TL13_1439 (atoB)
   00630 Glyoxylate and dicarboxylate metabolism
    TL13_1439 (atoB)
   00640 Propanoate metabolism
    TL13_1439 (atoB)
   00650 Butanoate metabolism
    TL13_1439 (atoB)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    TL13_1439 (atoB)
   00072 Synthesis and degradation of ketone bodies
    TL13_1439 (atoB)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    TL13_1439 (atoB)
   00310 Lysine degradation
    TL13_1439 (atoB)
   00380 Tryptophan metabolism
    TL13_1439 (atoB)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    TL13_1439 (atoB)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    TL13_1439 (atoB)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    TL13_1439 (atoB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ssut04147]
    TL13_1439 (atoB)
Enzymes [BR:ssut01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     TL13_1439 (atoB)
Exosome [BR:ssut04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   TL13_1439 (atoB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt FKBP_N
Motif
Other DBs
NCBI-ProteinID: AGL48364
Position
1452749..1453933
Genome map
AA seq 394 aa AA seqDB search
MKKVAIVSAYRSAIGSFGGSLKDIEIADLGAQVLETALASKNIPADSVDEVIFGNVLSAG
QGQNIARQIAIRAGIPQTASAYAVNKVCGSGLKSVLLAAQSIMLGENDVVVAGGIEIMSQ
APYLSKTSRFGSKFGHITLEDSMLTDGLTDAFNDYHMGITAENVAEHYQVSRAEQDAFTY
SSQEKAAKAIAEGRFVDEIVPIRLKNRKGETIFATDEYPRLTPIEKLATLRPSFKKDGTV
TAANASGINDGCAVLVLMSDEKASELNIQPLAYIEAYATSGLDPAYMGLGPITASQKALQ
KLNKTVEDIDLFELNEAFAAQSIPVVKQLGIDPAKVNVNGGAIALGHPIGASGSRILVTL
IHELIKQEKELGLCSLCIGGGQGISLIVSNAQTS
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaagtagctatcgtgtctgcctatcgttctgccatcggcagtttcggaggtagt
ctgaaagatattgaaatcgctgatttaggggcgcaagtcctcgaaacagccttagctagt
aaaaacatccctgcagacagcgttgatgaagttatcttcggaaatgttctttcagcagga
caaggacaaaatattgcacgtcaaattgctattcgtgcaggcattcctcagacagcctct
gcctatgcagtcaataaagtctgtggttccggtctcaaatcagtcctcctggctgcccag
tcaatcatgctaggtgaaaatgatgtagttgtggctgggggcattgaaatcatgagccag
gcaccctatctatccaaaactagccgttttggtagtaaatttggtcatattactctagaa
gattctatgctgacagacggtctaacagatgccttcaacgactatcacatgggcattact
gcagaaaatgttgctgaacactatcaagtcagtcgcgcagagcaagatgcttttacatac
agtagccaagagaaggctgcgaaagctattgctgagggaagatttgttgacgaaattgtt
cctattagactaaaaaatcggaaaggcgaaactatttttgccacagatgagtaccctcgt
ctgacgccaattgaaaaattggcaacacttcggccatcttttaaaaaggatggaaccgtc
acagcagccaatgcttctggcatcaacgacggctgtgctgtcttggtactcatgtctgat
gaaaaagccagtgagctcaatatccagccactcgcctatattgaggcctatgcaacaagc
ggtttagatcctgcctatatggggttaggtcctattactgctagccaaaaagcgctacaa
aaactgaataaaacagtcgaggatatcgatctattcgaactcaatgaagctttcgcagcc
caatcaattccagttgtcaaacaactcggcattgatcctgcaaaagtcaatgtcaatggt
ggtgctatcgcccttggacatccaatcggagctagtggtagtcgaatcctagtcactctg
attcacgaattaatcaagcaagaaaaagagcttggtctttgctcactttgtatcggaggc
ggtcaaggcatctccctaatcgtttccaatgcgcaaacaagttaa

DBGET integrated database retrieval system