KEGG   Streptococcus suis TL13 (serotype 16): TL13_1511Help
Entry
TL13_1511         CDS       T02672                                 

Gene name
glr
Definition
(GenBank) Glutamate racemase
  KO
K01776  glutamate racemase [EC:5.1.1.3]
Organism
ssut  Streptococcus suis TL13 (serotype 16)
Pathway
ssut00471  D-Glutamine and D-glutamate metabolism
ssut01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ssut00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    TL13_1511 (glr)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:ssut01011]
    TL13_1511 (glr)
Enzymes [BR:ssut01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.3  glutamate racemase
     TL13_1511 (glr)
Peptidoglycan biosynthesis and degradation proteins [BR:ssut01011]
 Precursor biosynthesis
  Racemase
   TL13_1511 (glr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Asp_Glu_race Repressor_Mnt
Motif
Other DBs
NCBI-ProteinID: AGL48436
Position
complement(1519390..1520184)
Genome map
AA seq 264 aa AA seqDB search
MDNRPIGFLDSGVGGLTVARELMRQLPHEEIVYIGDSARAPYGPRPAEQIREYTWQLVNF
LLTKNVKMIVFACNTATAVAWEEVKEKLDIPVLGVILPGASAAIKATQTGKVGVLGTAMT
IQSDIYREKIQALSPETQVDSLACPKFAPLVESNSHQSSLAKKVVYETLRPLVGKVDTLV
LGCTHYPLLRPIIQNAMGKEVKLIDSGAECARDISVLLNYFQINRSRTEKDIQHRFYTTA
SPAAFKEIAESWMGIDIHVEHVEL
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atggataatcgaccaataggttttttagattcaggtgtggggggattaacggttgcgcgt
gagttaatgcgccaacttccccatgaagaaatcgtttatatcggggactcggcacgggca
ccttatggcccccgtccagcagaacaaatcagagaatatacgtggcagttggtcaatttc
cttttgacaaaaaatgtaaaaatgattgtctttgcctgcaatacggcaacagcggtagcc
tgggaagaagtcaaggaaaagttggatattcctgttttgggagttattttaccaggtgct
tcggcagctattaaggcaacgcaaactggtaaggttggtgtcttaggaacggctatgact
attcaatccgatatctatcgtgaaaaaattcaggccctttctccggaaacgcaggtagac
agtctggcctgtcccaagtttgcccctctggttgagtccaatagccaccaatccagtctt
gccaaaaaggttgtttatgagacacttcgaccactcgttgggaaagtggacaccttggtt
ttgggctgcacccattatcctctgcttcgccccatcatccagaatgccatgggcaaggag
gtcaagttgatcgatagtggtgcagagtgtgcgcgagatatttctgttttattaaattat
tttcaaatcaaccgcagccgaaccgaaaaggatattcagcacagattttacacaacagct
agtccagcagccttcaaggaaattgctgaaagctggatgggcattgatattcatgtggag
catgtagaactatga

DBGET integrated database retrieval system