KEGG   Streptococcus suis YB51 (serotype 3): YB51_3875Help
Entry
YB51_3875         CDS       T03173                                 

Definition
(GenBank) Ornithine carbamoyltransferase
  KO
K00611  ornithine carbamoyltransferase [EC:2.1.3.3]
Organism
ssuy  Streptococcus suis YB51 (serotype 3)
Pathway
ssuy00220  Arginine biosynthesis
ssuy01100  Metabolic pathways
ssuy01110  Biosynthesis of secondary metabolites
ssuy01130  Biosynthesis of antibiotics
ssuy01230  Biosynthesis of amino acids
Module
ssuy_M00844  Arginine biosynthesis, ornithine => arginine
Brite
KEGG Orthology (KO) [BR:ssuy00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    YB51_3875
Enzymes [BR:ssuy01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.3  ornithine carbamoyltransferase
     YB51_3875
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OTCace OTCace_N
Motif
Other DBs
NCBI-ProteinID: AGW87147
Position
795325..796338
Genome map
AA seq 337 aa AA seqDB search
MTNVFKGRHFLAEKDFTRAELEWLIDFSAHLKDLKKRNIPHRYLEGKNIALLFEKTSTRT
RAAFTVASIDLGAHPEYLGANDIQLGKKESTEDTAKVLGRMFDGIEFRGFSQKMVEELAE
FSGVPVWNGLTDAWHPTQMLADYLTVKENFGKLEGLTLVYCGDGRNNVANSLLVTGAILG
VNVHIFSPKELFPEEEVVALAEVFAKESGARVLITDNADEAVKGADVLYTDVWVSMGEED
KFAERVALLKPYQVNMELVKKAENENLIFLHCLPAFHDTNTVYGKDVAEKFGVEEMEVTD
EVFRSKYARHFDQAENRMHTIKAVMAATLGDPFVPRV
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgacaaacgtatttaaaggtagacatttccttgcagagaaagatttcacacgcgcagaa
ttggaatggttgattgatttctcagctcatttgaaagatttgaaaaaacgcaatattcca
caccgttatttggaaggtaaaaatattgccctcttgtttgaaaaaacatcaacacgtact
cgtgctgccttcacagtagcatctattgaccttggtgcccatccagaatatcttggtgca
aatgatatccaacttggtaagaaagaatctacagaagatactgctaaagttttggggcgt
atgttcgacggtattgaattccgtggtttcagtcaaaaaatggtggaagaattggcagaa
ttctctggtgtgccagtatggaatggtttgacagatgcatggcacccaactcaaatgttg
gcggactacttgactgtcaaagaaaactttggcaagttggaaggtttgactctggtttac
tgtggtgatggtcgtaacaacgttgccaactctctcttggtgacaggtgctatccttggt
gtcaatgtccatatcttctctccaaaagaactcttcccagaagaagaagtagttgccttg
gctgaagtttttgcgaaagaaagtggagcacgtgttctcattactgataatgctgacgaa
gcagtcaaaggtgcagatgttctttatactgacgtttgggtatcaatgggtgaagaagat
aaatttgcagaacgcgttgccctcttgaaaccataccaagtgaatatggaattggtgaaa
aaagcagaaaatgaaaatctcatcttcttgcactgcttgcctgccttccatgatacaaac
actgtttatggtaaagatgtcgctgaaaaattcggcgtagaagaaatggaagtaacagac
gaagtattccgtagcaaatatgctcgtcacttcgaccaagctgaaaaccgtatgcacact
attaaagcagtgatggcggctactttaggggatccatttgttccacgtgtgtaa

DBGET integrated database retrieval system