KEGG   Streptococcus suis YB51 (serotype 3): YB51_3965Help
Entry
YB51_3965         CDS       T03173                                 

Definition
(GenBank) D-alanine--poly(phosphoribitol) ligase subunit 2
  KO
K14188  D-alanine--poly(phosphoribitol) ligase subunit 2 [EC:6.1.1.13]
Organism
ssuy  Streptococcus suis YB51 (serotype 3)
Pathway
ssuy00473  D-Alanine metabolism
ssuy01100  Metabolic pathways
ssuy01503  Cationic antimicrobial peptide (CAMP) resistance
ssuy02020  Two-component system
Brite
KEGG Orthology (KO) [BR:ssuy00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    YB51_3965
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    YB51_3965
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01503 Cationic antimicrobial peptide (CAMP) resistance
    YB51_3965
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   01504 Antimicrobial resistance genes [BR:ssuy01504]
    YB51_3965
Enzymes [BR:ssuy01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.13  D-alanine---poly(phosphoribitol) ligase
     YB51_3965
Antimicrobial resistance genes [BR:ssuy01504]
 Gene sets
  CAMP resistance modules
   Cationic antimicrobial peptide (CAMP) resistance, dltABCD operon [MD:M00725]
    YB51_3965
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PP-binding Ribosomal_L12_N
Motif
Other DBs
NCBI-ProteinID: AGW87165
Position
822744..822983
Genome map
AA seq 79 aa AA seqDB search
MDVKETILNIIEELFMEDVSEMMDEDLFDAGVLDSMGTVELIVELESRFNITVPVSEFGR
EDWNTANKIISGVVELMHA
NT seq 240 nt NT seq  +upstreamnt  +downstreamnt
atggatgtaaaagaaacaatattgaatattatcgaagaattatttatggaagatgtatct
gaaatgatggatgaagacctatttgatgcgggtgttttggatagtatgggaactgtagaa
cttattgtggagttagaaagtcgttttaatattacagttccagtttcagagtttggtcgt
gaagattggaatacagctaacaaaatcatttctggtgttgtggagttgatgcatgcgtaa

DBGET integrated database retrieval system