KEGG   Streptococcus suis YB51 (serotype 3): YB51_6425Help
Entry
YB51_6425         CDS       T03173                                 

Definition
(GenBank) putative NagD-like phosphatase
  KO
K01101  4-nitrophenyl phosphatase [EC:3.1.3.41]
Organism
ssuy  Streptococcus suis YB51 (serotype 3)
Pathway
ssuy00627  Aminobenzoate degradation
ssuy01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ssuy00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    YB51_6425
Enzymes [BR:ssuy01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.41  4-nitrophenylphosphatase
     YB51_6425
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hydrolase_like Hydrolase_6 HAD_2 Hydrolase Hydrolase_3
Motif
Other DBs
NCBI-ProteinID: AGW87657
Position
complement(1313821..1314594)
Genome map
AA seq 257 aa AA seqDB search
MTYTGYLIDLDGTIYEGKKRIPAGERFIHRLQECQISYLFVTNNTTRRPEMVQAMLAENF
NIETPLETIYTASLATVDYMNDLGKEKTVYVIGEDGLKSAIFEAGYVEDTENPAYVVVGL
DTQLTYEKLTIATLAIQKGATFIGTNPDLNIPTERGHLPGAGSLIALLKAATRVEPTFIG
KPEVIIMDKALEILGTERSQTVMVGDNYLTDIRAGIDNGFPTLLVLTGFTKPEEVADLPL
APTHVLNSLDEWSFDEN
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atgacatatacaggttatttgattgatttggatggtacgatttatgaagggaaaaagcgg
attcctgctggtgaacgttttattcatcgcttgcaagaatgtcagatttcctatttattt
gtgaccaacaataccacccgccgtcctgagatggtgcaggctatgttggctgaaaacttt
aacattgagacaccgcttgaaacaatctatacagccagtctggcgacagtagattatatg
aatgacttgggcaaggaaaagacagtctatgtcattggagaagacgggctcaagtctgcc
atttttgaggcaggttatgtggaagacacggaaaatccagcctatgttgttgtcggtttg
gatactcagttgacctatgaaaaactgaccattgccaccttagctattcaaaagggagcg
acctttatcggtaccaatcctgatttgaacattccgactgaaagaggtcatttgccagga
gcaggctcacttattgcgcttttgaaagctgctacccgagtagagccgacctttatcggt
aagcctgaagtcattatcatggacaaggctctggagattttaggcacagaacgcagccag
acagttatggtaggagataactacctgacagatattcgtgcagggattgacaatggattt
ccaactcttttagtcctgacaggatttaccaagccagaagaagtagcagacttacccctg
gctccaacccatgtcctcaacagcctagatgaatggagttttgatgagaactaa

DBGET integrated database retrieval system