KEGG   Streptococcus suis YB51 (serotype 3): YB51_7325Help
Entry
YB51_7325         CDS       T03173                                 

Definition
(GenBank) 3-ketoacyl-CoA thiolase / Acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
ssuy  Streptococcus suis YB51 (serotype 3)
Pathway
ssuy00071  Fatty acid degradation
ssuy00072  Synthesis and degradation of ketone bodies
ssuy00280  Valine, leucine and isoleucine degradation
ssuy00362  Benzoate degradation
ssuy00380  Tryptophan metabolism
ssuy00620  Pyruvate metabolism
ssuy00630  Glyoxylate and dicarboxylate metabolism
ssuy00640  Propanoate metabolism
ssuy00650  Butanoate metabolism
ssuy00900  Terpenoid backbone biosynthesis
ssuy01100  Metabolic pathways
ssuy01110  Biosynthesis of secondary metabolites
ssuy01120  Microbial metabolism in diverse environments
ssuy01130  Biosynthesis of antibiotics
ssuy01200  Carbon metabolism
ssuy01212  Fatty acid metabolism
ssuy02020  Two-component system
Brite
KEGG Orthology (KO) [BR:ssuy00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    YB51_7325
   00630 Glyoxylate and dicarboxylate metabolism
    YB51_7325
   00640 Propanoate metabolism
    YB51_7325
   00650 Butanoate metabolism
    YB51_7325
  09103 Lipid metabolism
   00071 Fatty acid degradation
    YB51_7325
   00072 Synthesis and degradation of ketone bodies
    YB51_7325
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    YB51_7325
   00310 Lysine degradation
    YB51_7325
   00380 Tryptophan metabolism
    YB51_7325
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    YB51_7325
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    YB51_7325
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    YB51_7325
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ssuy04147]
    YB51_7325
Enzymes [BR:ssuy01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     YB51_7325
Exosome [BR:ssuy04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   YB51_7325
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AGW87837
Position
1488085..1489269
Genome map
AA seq 394 aa AA seqDB search
MKKVAIVSAYRSAIGSFGGSLKDIEIADLGAQVLETALANKNIPADSVDEVIFGNVLSAG
QGQNIARQIAIRAGIPQTASAYAVNKVCGSGLKSVLLAAQSIMLGDNDVVVAGGIEIMSQ
APYLSKTSRFGSKFGHVSLEDSMLTDGLTDAFNDYHMGITAENVAERYHVSRAEQDAFTY
SSQEKAAKAIAEGRFVDEIVPIRLKNRKGETIFATDEYPRLTPIEKLATLRPSFKKEGTV
TAANASGINDGCAVLVLMSDEKASELNIQPLAYIEAYATSGLDPALMGLGPITASQKALQ
KLNKTVEDIDLFELNEAFAAQSIPVVKQLGIDPAKVNVNGGAIALGHPIGASGSRILVTL
IHELIKQEKELGLCSLCIGGGQGISLIVSNAQTN
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaagtagctatcgtgtctgcctatcgttctgccatcggcagtttcggaggtagt
ctgaaagatattgaaatcgctgatttaggggcgcaagtcctcgaaacagccttagctaat
aaaaacatccctgcagacagcgttgatgaagttatcttcggaaatgttctttcagcagga
caaggacaaaatattgcacgtcaaattgctattcgtgcaggcattcctcagacagcctct
gcctatgcagtcaataaagtctgtggttccggtctcaaatcagtcctcctagctgcccag
tcaatcatgctaggtgacaatgatgtagttgtggctggaggcattgaaattatgagccag
gcaccttatctatccaaaactagccggtttggtagtaaatttggtcatgttagtctggaa
gattccatgttaacagatggtttgacagatgccttcaacgactatcacatgggcattact
gcagaaaatgttgctgaacgctatcatgtcagtcgcgcagagcaagatgcttttacatac
agtagccaagagaaggctgcaaaagctattgctgagggaagatttgttgacgaaattgtt
cctattagattaaaaaatcggaaaggcgaaactatttttgccacagatgagtaccctcgt
ctgacgccaattgaaaaattggcaacacttcggccatcttttaaaaaggaaggaaccgtc
accgcagccaatgcttctggcatcaacgacggctgtgctgtcttggtactcatgtctgat
gaaaaagccagtgagctaaatatccagccactcgcctatattgaggcctatgcaacaagc
ggtttagatcctgcattgatggggcttggacctattactgctagccaaaaagcgctacaa
aaactgaataaaacagtcgaggatatcgatctattcgaactcaatgaagcattcgcagcc
caatcaattccagttgtcaaacaactcggcattgatcctgcaaaagtcaatgtcaatggt
ggtgctatagcccttggacatccaatcggagctagtggtagtcgaatcctagtcactctg
attcacgaattaatcaagcaagaaaaagagcttggtctttgctcactttgtatcggaggc
ggtcaaggcatctccctaatcgtttccaatgcgcaaacaaattaa

DBGET integrated database retrieval system