KEGG   Streptococcus suis 98HAH33 (serotype 2): SSU98_0713
Entry
SSU98_0713        CDS       T00515                                 

Name
(GenBank) Pyruvate-formate lyase
Organism
ssv  Streptococcus suis 98HAH33 (serotype 2)
SSDB
Motif
Pfam: PFL-like Gly_radical
Other DBs
NCBI-ProteinID: ABP91871
Position
689314..691758
AA seq 814 aa
MKTVTEVAGTSIKTEYFGSLTDRMNKYREDVLDKKPYIDAERAVLATKAYQEHREKPNVL
KRAYMLKEILENMTLYIEEESLIAGNQASSNKDAPIFPEYTLEFVLNELDLFEKRDGDVF
YITEETKEQLRSIAPFWEKNNLRSRAGVLLPEEVQVYMETGFFGMEGKMNSGDAHLAVNY
QKVLEQGLRGFEERVRVAKANLDLTDPASIDKYHFYDSIFIIIDAVKAYADRFVALATEL
AEKAPTAQRRQELLEIARICAKVPYEPAETFAEAVQSVWFIQCILQIESNGHSLSYGRFD
QYMYPYVKADLEAGRETEDSIVERLTNLWIKTITINKVRSQSHTFSSAGSPLYQNVTIGG
QTRDKKDAVNPLSYLVLKSVAQTHLPQPNLTVRYHAGLDARFMNECIEVMKLGFGMPAFN
NDEIIIPSFIEKGVLEEDAYDYSAIGCVETAVPGKWGYRCTGMSYMNFPKVLLITMNDGI
DPASGKRFAPAFGHFKDMKSFEVLETAWEKTLRHLTRMSVIVENAIDIALEREVPDILCS
ALTDDCIGRGKHLKEGGAIYDYISGLQVGIANLSDSLAAIKKLVFEEGRLTPEELWHALE
TDYAGERGKEIQEMLIEDAPKYGNDDDYADQLVTAAYDIYINEIAKYPNTRFGRGPIGGI
RYSGTSSISANVGQGRGTLATPDGRNAGTPLAEGCSPSHNMDKNGPTSVLKSVAKLPTHE
IVGGVLLNQKVNPQTLAKEEDKQKLIALLRTFFNRLHGYHIQYNVVSRETLIDAQLHPEK
HRDLIVRVAGYSAFFNVLSRATQDDIIGRTEHTL
NT seq 2445 nt   +upstreamnt  +downstreamnt
atgaaaacagtgactgaagtagctggcactagcattaaaactgagtattttggaagtctg
actgatcggatgaacaaatacagagaagatgtccttgataagaagccctatattgacgcg
gaacgggctgttttagcaacaaaagcctatcaagaacatagagagaagcccaatgtatta
aaaagggcctatatgctcaaggaaatattggagaacatgacgctttatattgaagaagaa
agtctgattgcaggtaaccaagcttcttcaaataaagatgctcccatcttcccagaatat
accttggagtttgtattgaatgaattggatttattcgaaaaacgggatggggatgtcttc
tatattaccgaggaaactaaagagcagttgcgcagcatcgctccattctgggaaaagaat
aatcttcgttcacgtgcaggtgtcttgcttccagaagaagttcaagtttatatggaaact
ggcttctttggtatggaaggtaagatgaactctggcgatgcccacttggctgtcaattac
caaaaggtattggaacaaggtttgcgtggttttgaggagcgagttcgtgtagcaaaggct
aatctcgatttgacggatcctgcaagtattgataaatatcatttctatgactcaatcttt
atcatcattgatgcggtgaaagcatacgcagatcgttttgtcgccttggctactgaattg
gcagagaaagcaccaacagctcaacgccgtcaagaactactggagattgcacggatttgt
gcgaaggtgccgtatgaacctgctgaaacatttgcagaggcagtgcaatcggtctggttt
atccagtgtatcttgcaaatcgagtccaatggacattctctatcctatggacgtttcgac
caatacatgtatccgtatgtgaaagctgatttagaagcaggacgtgaaacggaagacagc
atcgtcgaacgcttaactaacttgtggattaagaccattactatcaacaaggttcgtagt
caatcacataccttctcatctgctggtagtccactataccaaaatgtaaccattggtgga
caaacacgtgataagaaggatgctgtcaatccactttcttacttagtattgaaatctgtt
gcccaaacacacctgccacagccaaacttgactgttcgctatcatgcaggcctagatgct
cgcttcatgaatgaatgtattgaagtcatgaaacttggttttggtatgcctgcctttaac
aacgatgaaattatcattccctcctttatcgagaaaggtgtcttggaagaagatgcctat
gactacagtgcgattggctgtgtagaaacggctgttcctggtaaatggggataccgttgt
acaggtatgagctatatgaacttcccgaaagttttattgattaccatgaatgatggtatc
gatcctgcatcaggcaaacggtttgcaccagcctttggtcacttcaaagatatgaaatcc
tttgaagtgcttgaaacggcatgggaaaagacacttcgtcatctaacacggatgagtgtc
atcgttgaaaatgcaattgacattgctttagaaagagaagtaccagacattctctgctca
gctctgacagatgactgtatcggtcgtggtaagcacctgaaagaaggtggagcgatttac
gattacatttctggtctgcaggttggcattgccaatttatctgattctctagcagcaatc
aaaaaattagtctttgaagaaggacgattgactccagaagaattatggcatgctttggaa
acagactatgctggggagcgtggtaaagaaatccaggaaatgttgattgaagatgcacca
aaatatggtaacgatgatgattatgcagaccaattggtaacagcagcatatgatatttat
atcaatgagattgccaaatatccaaacactcgctttggtcgtggtccgattggtggtatc
cgctattcaggtacatcatccatttcagccaacgttggacaggggcgtggtactttggca
actccagacggtcgcaatgcaggaacaccgttggcagaaggttgttctccatcacataat
atggataaaaatggaccgacatccgttttgaaatcagttgccaaattaccaacacatgaa
attgttggaggcgttctgctcaatcagaaggtcaatccacaaacacttgccaaagaagaa
gacaaacaaaaattaattgccctcttgcggacattctttaaccgcttgcatggctatcat
attcagtacaatgttgtctctcgagaaaccttgattgatgcacaactacatcctgaaaaa
caccgtgatttgattgtccgtgtagcaggttattcagcattcttcaatgtattgtcgaga
gcaacacaagacgacatcattggtcgtacagaacatacattgtaa

DBGET integrated database retrieval system