KEGG   Streptococcus suis 98HAH33 (serotype 2): SSU98_0061Help
Entry
SSU98_0061        CDS       T00515                                 

Definition
(GenBank) Holliday junction resolvasome, DNA-binding subunit
  KO
K03550  holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
ssv  Streptococcus suis 98HAH33 (serotype 2)
Pathway
ssv03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:ssv00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    SSU98_0061
Enzymes [BR:ssv01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     SSU98_0061
DNA repair and recombination proteins [BR:ssv03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     SSU98_0061
    RecFOR pathway proteins
     SSU98_0061
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuvA_N HHH_5 RuvA_C HHH HHH_3 Ribosomal_S13 PTPS
Motif
Other DBs
NCBI-ProteinID: ABP91221
UniProt: A4VYN2
Position
64521..65111
Genome map
AA seq 196 aa AA seqDB search
MYDYIKGILTKITAKYIVVETQGVGYILQVANPYAYSGQVQQEVTVYTHQVIREDAHLLY
GFATENEKSVFLSLISVSGIGPTTALAIIAVDDNDGLVRAIEQKNITYLTKFPKIGKKTA
QQMILDLEGKFVMSEEAGPVQQVAPSSENIALEEAMEAMEALGYRPAELKKIKKFFEGTN
DTAENYIKSALKMLMK
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
atgtacgactatattaaaggaattttaacaaaaataactgcaaaatacattgtggtagaa
acgcaaggagtaggctatatcttgcaggttgctaatccctacgcctattcaggacaagtc
cagcaagaagtgactgtctatactcatcaggtgattcgtgaagatgctcatttgctctac
ggatttgctacagaaaatgaaaaatccgtctttctgagtctgatttcagtatcaggtatt
ggtccaacaacagctctggctattattgctgttgatgataatgatggacttgttcgtgct
atcgagcagaaaaacattacctacctgaccaaatttccaaagattggcaagaaaacagcc
cagcagatgattttggacttggaaggcaagtttgtcatgagcgaagaagcgggtcctgtt
caacaagtagcaccatccagtgaaaatatcgcccttgaagaagccatggaagccatggaa
gcccttggttaccgcccagccgaactcaagaaaatcaagaaattctttgaaggcaccaac
gacaccgcagaaaactacatcaagtcagcccttaaaatgctgatgaagtaa

DBGET integrated database retrieval system