KEGG   Streptococcus suis 98HAH33 (serotype 2): SSU98_0716Help
Entry
SSU98_0716        CDS       T00515                                 

Definition
(GenBank) Glycerol dehydrogenase and related enzyme
  KO
K00005  glycerol dehydrogenase [EC:1.1.1.6]
Organism
ssv  Streptococcus suis 98HAH33 (serotype 2)
Pathway
ssv00561  Glycerolipid metabolism
ssv00640  Propanoate metabolism
ssv01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ssv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    SSU98_0716
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    SSU98_0716
Enzymes [BR:ssv01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.6  glycerol dehydrogenase
     SSU98_0716
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fe-ADH Fe-ADH_2 DHQ_synthase
Motif
Other DBs
NCBI-ProteinID: ABP91874
Position
693550..694644
Genome map
AA seq 364 aa AA seqDB search
MKVFASPSRYIQGKHVLFQGAEAIGKLGTKPLILCDDLVYGIIGEKFLSYLVEEGMQVHR
VAFNGEASDKEIQRVVEIGKEQASDVVIGLGGGKTIDSAKAIADLLGVPVVIAPTIASTD
APTSALSVIYSEEGAFERYIFYKKNPDLVLVDTAIICQAPPRLLASGIADGLATWVEARA
ILQSNGTTMAGGGQTLAGIAIAQTCEQTLFEYGLQAMASCEAKVVTAALENIVEANTLLS
GLGFESAGLAAAHAIHNGFTALEGDIHHLTHGEKVAYGTLTQLFLENRPKEELEKYIRFY
QALNLPTTLEELHLADASYEELLKVGQQATIEGETIHGMPFAISAEDVAEALMAVDYYVR
SLDK
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtatttgcaagtccatctcgctatattcaaggtaaacatgtccttttccaaggt
gcagaagctatcggaaaattgggaacaaagcctttgattctttgtgatgatttagtatat
gggattatcggtgagaagtttttgtcctatctcgttgaagaagggatgcaagtccatcgt
gttgcctttaatggagaagcatctgacaaggaaatccagcgcgtcgtagaaatcggaaaa
gaacaggctagtgacgtcgtaatcggtctaggtggtggcaagacgattgactcagccaag
gcgattgctgatttactaggagtgccagttgtcattgctccaactattgcttcaacagat
gctccgacctctgctttatctgtcatttattctgaagaaggggcgtttgaacgctatatt
ttctataagaaaaatccagatcttgtcttggtagatacagcgattatttgtcaagcaccg
ccacgtcttttggcttctggtattgcggatggcttggcgacgtgggtggaagcgcgtgct
attttacaaagcaatggaacaacaatggcaggaggaggtcagacacttgctggtatcgct
attgcacaaacctgtgaacaaacactctttgaatacggacttcaagccatggccagctgt
gaagccaaggttgtgacagctgctttagagaatattgttgaagccaataccttgctaagt
ggtttaggctttgaaagtgcaggtttggctgcggcgcatgcgatacacaatggattcacc
gccttggagggagacattcaccatttgacacatggtgaaaaagtggcttatgggaccttg
acccagctctttttggaaaaccgtcctaaagaagaattggaaaaatacatccgtttctat
caagccttgaatcttccaacaactttggaggagttacatttggctgatgctagttatgaa
gaactattgaaagtcggccaacaagcgacgattgaaggagaaacaattcacggtatgcca
tttgctatttcagcagaagacgttgcagaagctctgatggcagttgactactatgttcgc
tcattagataaataa

DBGET integrated database retrieval system