KEGG   Streptococcus suis 98HAH33 (serotype 2): SSU98_0832Help
Entry
SSU98_0832        CDS       T00515                                 

Definition
(GenBank) Transcriptional regulator/sugar kinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
ssv  Streptococcus suis 98HAH33 (serotype 2)
Pathway
ssv00010  Glycolysis / Gluconeogenesis
ssv00052  Galactose metabolism
ssv00500  Starch and sucrose metabolism
ssv00520  Amino sugar and nucleotide sugar metabolism
ssv00521  Streptomycin biosynthesis
ssv01100  Metabolic pathways
ssv01110  Biosynthesis of secondary metabolites
ssv01120  Microbial metabolism in diverse environments
ssv01130  Biosynthesis of antibiotics
ssv01200  Carbon metabolism
Module
ssv_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
ssv_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:ssv00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SSU98_0832
   00052 Galactose metabolism
    SSU98_0832
   00500 Starch and sucrose metabolism
    SSU98_0832
   00520 Amino sugar and nucleotide sugar metabolism
    SSU98_0832
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    SSU98_0832
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    SSU98_0832
Enzymes [BR:ssv01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     SSU98_0832
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK Glucokinase BcrAD_BadFG FGGY_N M11L
Motif
Other DBs
NCBI-ProteinID: ABP91990
Position
810042..811040
Genome map
AA seq 332 aa AA seqDB search
MCYNKENTFEVMIMSKKIIGIDLGGTSVKLAILTTEGEIQEKWSIKTNILDDGSHIVPDI
IDSIKQRFETHGLTKDDFLGIGMGSPGVVDSEAGTVIGAYNLNWKTLQLVKEQFESALGL
PFFIDNDANVAALGEQWVGAGNNNPNVVFMTLGTGVGGGVIAAGNLIRGVKGAGGELGHI
TVDFDEPFACTCGKKGCLETVASATGIVNLSRRYADQYAGDAKLKQMIDDGQDVTAKDVF
DLAKEGDDLALIVYRHFSEYLGVACANIAAVLNPAYIVLGGGVSAAGEFLLDGVRKVFAE
NSFPQIKESTQIVLATRGNDAGVLGAASLVLK
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
ttgtgttataataaagaaaatacatttgaggtgatgattatgtctaaaaaaattatcggt
attgaccttgggggaacttctgttaaattggccattttgactactgagggagaaattcaa
gaaaaatggtctatcaagacaaatattttagatgatggaagtcatattgttcctgatatt
attgacagtatcaagcagcgatttgaaacccatggtttgacaaaggacgatttcttagga
attggtatgggctcacccggtgtagtggatagtgaagctggcactgttatcggagcctat
aacctcaactggaagaccttgcaattggtcaaagagcagtttgaatctgcgctcggttta
ccattctttattgacaatgatgcaaacgtagcggccctcggtgaacaatgggttggtgct
ggaaacaacaatccaaacgttgtctttatgacgcttggtacaggtgtcggtggcggtgtc
atcgctgctggaaacttgattcgtggtgtcaaaggtgctggtggcgaattgggccatatc
acagttgactttgatgagccatttgcatgtacttgtggtaagaaaggttgtctagaaaca
gttgcttcagcgacaggtattgtcaacctcagccgtcgctatgctgatcaatacgcaggc
gatgcaaaactgaaacaaatgattgatgatgggcaagatgtaacggctaaagatgtcttt
gatttggcaaaagagggcgatgatttggctttgattgtctaccgtcacttctcagaatac
ttaggtgttgcttgtgcaaacattgctgcagtcctcaatcctgcctacatcgttcttggt
ggtggtgtatcagctgcgggagagttcttattggatggcgttcgcaaggtctttgctgaa
aatagcttcccacaaatcaaggaaagtacacaaattgtcttggcaacacgtggtaatgat
gcaggtgtattgggcgcagcatcactcgtcttgaaataa

DBGET integrated database retrieval system