KEGG   Streptococcus suis 98HAH33 (serotype 2): SSU98_0937Help
Entry
SSU98_0937        CDS       T00515                                 

Definition
(GenBank) hypothetical protein
Organism
ssv  Streptococcus suis 98HAH33 (serotype 2)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FtsK_SpoIIIE DUF87 AAA_10 TrwB_AAD_bind ResIII T2SSE Pox_A32 AAA AAA_19 Calcyon DUF853 AAA_22
Motif
Other DBs
NCBI-ProteinID: ABP92095
Position
complement(903523..904908)
Genome map
AA seq 461 aa AA seqDB search
MKQRGKRIRPSGKDLVFHFTIASLLPVFLLVVGLFHVKTIQQINWQDFNLSQADKIDIPY
LIISFSVAILICLLVAFVFKRVRYDTVKQLYHRQKLAKMILENKWYESEQVKTEGFFKDS
AGRTKEKITYFPKMYYRLKNGLIQIRVEITLGKYQDQLLHLEKKLESGLYCELTDKELKD
SYVEYTLLYDTIASRISIDEVEAKDGKLRLMKNVWWEYDKLPHMLIAGGTGGGKTYFILT
LIEALLHTDSKLYILDPKNADLADLGSVMANVYYRKEDLLSCIETFYEEMMKRSEEMKQM
KNYKTGKNYAYLGLPAHFLIFDEYVAFMEMLGTKENTAVMNKLKQIVMLGRQAGFFLILA
CQRPDAKYLGDGIRDQFNFRVALGRMSEMGYGMMFGSDVQKDFFLKRIKGRGYVDVGTSV
ISEFYTPLVPKGYDFLEEIKKLSNSRQSTQATCEAEVAGVD
NT seq 1386 nt NT seq  +upstreamnt  +downstreamnt
atgaaacagcgtggtaaaaggattcgcccatctggtaaagatttagtctttcattttacg
atagcgtcactcctgcctgttttcctgctggttgtcggactgtttcatgtgaagacaatc
cagcagatcaactggcaggattttaacctatcacaagcagataagattgacattccctat
ttaattatcagtttcagtgtcgcaattcttatctgcttgctggtagcgtttgtattcaaa
cgggttcgctatgatacggttaaacaactttaccaccgtcaaaaactggcaaagatgata
cttgaaaacaagtggtatgaatctgaacaggtcaaaacagagggtttctttaaagatagt
gctggtcgtacaaaggaaaagataacctacttccctaaaatgtattatcgacttaaaaat
ggcttgatacagatacgggtggaaatcacgctgggaaaatatcaagaccaactcttacac
ttggaaaagaaattagagagtggcttgtactgtgagctgacggataaagagttaaaggat
tcctatgtggaatatactttgctctatgacaccatagccagtcgtatttctattgatgaa
gtagaagctaaagatggtaaacttcgcttaatgaaaaacgtatggtgggaatatgataag
ctccctcatatgttgattgctggtggtacaggtggcggtaaaacttactttatactgaca
ctgattgaagccttgcttcatacagattcaaaactgtatattcttgacccgaaaaatgct
gatcttgcggacttaggttctgtgatggcaaatgtctactatagaaaagaagacttgctt
tcttgcattgaaacattctatgaagaaatgatgaaacgtagtgaggaaatgaagcagatg
aagaactataagactggcaaaaattatgcttacttaggtctcccggcacacttcttaatc
tttgatgaatacgtcgctttcatggaaatgctgggaacaaaagaaaacaccgcagttatg
aataagctgaaacagattgtcatgttaggtcgtcaagctggcttctttctaatactggct
tgtcaacgtccagacgcaaaatatttaggcgacggaatccgtgatcagtttaatttcaga
gtggctttaggtcgtatgtctgaaatgggctatggcatgatgtttggcagtgacgtacaa
aaggatttcttcttaaagcgaatcaaaggtcgtggctatgttgatgtaggaacaagtgtc
atatcagagttttatactccccttgtaccaaaaggatatgatttcttggaggaaattaaa
aagttatccaacagcagacagtccacgcaggcgacgtgcgaagcggaagtcgcaggtgtg
gactga

DBGET integrated database retrieval system