KEGG   Streptococcus suis 98HAH33 (serotype 2): SSU98_1651Help
Entry
SSU98_1651        CDS       T00515                                 

Definition
(GenBank) Acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
ssv  Streptococcus suis 98HAH33 (serotype 2)
Pathway
ssv00071  Fatty acid degradation
ssv00072  Synthesis and degradation of ketone bodies
ssv00280  Valine, leucine and isoleucine degradation
ssv00362  Benzoate degradation
ssv00380  Tryptophan metabolism
ssv00620  Pyruvate metabolism
ssv00630  Glyoxylate and dicarboxylate metabolism
ssv00640  Propanoate metabolism
ssv00650  Butanoate metabolism
ssv00900  Terpenoid backbone biosynthesis
ssv01100  Metabolic pathways
ssv01110  Biosynthesis of secondary metabolites
ssv01120  Microbial metabolism in diverse environments
ssv01130  Biosynthesis of antibiotics
ssv01200  Carbon metabolism
ssv01212  Fatty acid metabolism
ssv02020  Two-component system
Brite
KEGG Orthology (KO) [BR:ssv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    SSU98_1651
   00630 Glyoxylate and dicarboxylate metabolism
    SSU98_1651
   00640 Propanoate metabolism
    SSU98_1651
   00650 Butanoate metabolism
    SSU98_1651
  09103 Lipid metabolism
   00071 Fatty acid degradation
    SSU98_1651
   00072 Synthesis and degradation of ketone bodies
    SSU98_1651
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SSU98_1651
   00310 Lysine degradation
    SSU98_1651
   00380 Tryptophan metabolism
    SSU98_1651
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    SSU98_1651
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    SSU98_1651
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    SSU98_1651
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ssv04147]
    SSU98_1651
Enzymes [BR:ssv01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     SSU98_1651
Exosome [BR:ssv04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SSU98_1651
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt FKBP_N
Motif
Other DBs
NCBI-ProteinID: ABP92809
Position
1553718..1554902
Genome map
AA seq 394 aa AA seqDB search
MKKVAIVSAYRSAIGSFGGSLKDIEIADLGAQVLETALASKNIPADSVDEVIFGNVLSAG
QGQNIARQIAIRAGIPQTASAYAVNKVCGSGLKSVLLAAQSIMLGDNDVVVAGGIEIMSQ
APYLSKTSRFGSKFGHITLEDSMLTDGLTDAFNDYHMGITAENVAEHYQVSRAEQDAFTY
SSQEKAAKAIAEGRFVDEIVPIRLKNRKGETIFATDEYPRLTPIEKLATLRPSFKKDGTV
TAANASGINDGCAVLILMSDEKASELNIQPLTYIEAYATSGLDPALMGLGPITASQKALQ
KLNKTVEDIDLFELNEAFAAQSIPVVKQLGIDPAKVNVNGGAIALGHPIGASGSRILVTL
IHELIKQEKELGLCSLCIGGGQGISLIVSNAQTS
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaagtagctatcgtgtctgcctatcgttctgccatcggcagtttcggaggtagt
ctgaaagatattgaaatcgctgatttaggggcgcaagtcctcgaaacagccttagctagt
aaaaacatccctgcagacagcgttgatgaagttatcttcggaaatgttctttcagcagga
caaggacaaaatattgcacgtcaaattgctattcgtgcaggcattcctcagacagcctct
gcctatgcagtcaataaagtctgtggttccggtctcaaatcagtcctcctggctgcccag
tcaatcatgctaggtgacaatgatgtagttgtggctggaggcattgaaattatgagccag
gcaccttatctatccaaaactagcaggtttggtagtaaatttggtcatattactctagaa
gattctatgctgacagacggtctaacagatgccttcaacgactatcacatgggcattact
gcagaaaatgttgctgaacactatcaagtcagtcgcgcagagcaagatgcttttacatac
agtagccaagagaaggctgcgaaagctattgctgagggaagatttgttgacgaaattgtt
cctattagattaaaaaatcggaaaggcgaaactatttttgccacagatgagtaccctcgt
ctgacgccaattgaaaaattggcaacacttcggccatcttttaaaaaggatggaaccgtc
accgcagccaatgcttctggcatcaacgacggctgtgctgtcttgatactcatgtctgat
gaaaaagccagtgagctaaatatccagccactcacctatattgaggcctatgcaacaagc
ggtttagatcccgcattgatggggcttggacctattactgctagccaaaaagcgctacaa
aaactgaataaaacagtcgaggatatcgatctattcgaactcaacgaggcatttgcagcc
caatcaattccagttgtcaaacaactcggcattgatcctgcaaaagtcaatgtcaatggt
ggtgctatcgcccttggacatccaatcggagctagtggtagtcgaatcctagtcactctg
attcacgaattaatcaagcaagaaaaagagcttggtctttgctcactttgtatcggaggc
ggtcaaggcatctccctaatcgtttccaatgcgcaaacaagttaa

DBGET integrated database retrieval system