KEGG   Streptococcus suis GZ1 (serotype 2): SSGZ1_0258Help
Entry
SSGZ1_0258        CDS       T02023                                 

Definition
(GenBank) Threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
ssw  Streptococcus suis GZ1 (serotype 2)
Pathway
ssw00260  Glycine, serine and threonine metabolism
ssw00750  Vitamin B6 metabolism
ssw01100  Metabolic pathways
ssw01110  Biosynthesis of secondary metabolites
ssw01120  Microbial metabolism in diverse environments
ssw01230  Biosynthesis of amino acids
Module
ssw_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:ssw00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SSGZ1_0258
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    SSGZ1_0258
Enzymes [BR:ssw01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     SSGZ1_0258
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thr_synth_N
Motif
Other DBs
NCBI-ProteinID: ADE30723
UniProt: D5AFV8
Position
271461..272957
Genome map
AA seq 498 aa AA seqDB search
MRDTMTLVYQSTRDAKNTVSASQAILQGLATDGGLFTPLSIPTVDLDFSVLKDASYQDVA
KLILSAFLDDFTADELDYCINNAYDSKFDTSVIAPVVKLKGQYNLELFRGSTIAFKDMAL
SILPYLMATATKKHGLENEIVILTATSGDTGKAAMAGFADVPGTQIIVFYPRDGVSKVQE
LQMTTQTGANTHVVAIDGNFDDAQTNVKHMFNDEALRAKLAAKKLQFSSANSMNIGRLVP
QIVYYVYAYAQLVKTGEIAAGDKVNFTVPTGNFGNILAAYYAKQIGLPVGKLICASNDNN
VLTDFFATGVYDKNRTFRVTTSPSMDILVSSNLERLIFHLFGNDAAKTAELMEALNTAGQ
YDIQGADAEILSLFAAAFATEEETAAEIKRVYDESDYIEDPHTAVASAVYKQYVEQTGDQ
TPTVIASTASPYKFPVVAVEAVTGQSGLSDFEALAKLHEISGVDLPPAVDGLETAPVRHN
TVVAAADMQTEVERYLGV
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atgagggataccatgacattagtatatcaatcaacacgcgatgctaaaaatactgtatcg
gctagtcaagcgattttgcagggcttggcgaccgacggtggtttgtttacaccgctttct
attccaacagttgacttggatttttctgttttgaaagatgcttcttatcaagacgttgcc
aagctgattttgtcggctttcttggatgattttacggcagatgagttggactactgtatc
aataacgcctacgacagtaagtttgacacgtcagttattgccccagtggttaagctaaaa
ggtcagtacaacttggagctcttccgtggctcaaccattgccttcaaggatatggctctg
tccatcctcccttacttgatggcgacggcgactaaaaagcacggtttggaaaacgaaatt
gtcatcctgaccgcgacttcaggcgatacaggcaaggcagccatggctggttttgcggac
gttcctggcacacaaatcattgtcttctatccgcgtgacggggtatctaaggtccaagaa
ttgcagatgaccacgcagacaggggctaatacccacgtggtggctattgacggtaacttc
gacgatgcccagaccaatgtcaaacacatgttcaacgatgaggcactccgtgccaagttg
gcggctaagaaactccagttttcatctgccaactctatgaacatcggccgcttggtgcca
cagattgtttactatgtctatgcctacgctcagctggttaagactggtgagattgcggcg
ggcgacaaggtcaacttcaccgttccaacaggaaactttggaaacatcttggcagcttat
tacgccaaacaaatcggtctgccagttggcaagctcatctgtgcgtccaacgacaacaat
gtcctaaccgacttcttcgcgacaggcgtttacgataagaaccgtaccttccgcgtgacc
accagtccgtccatggacatcttggtgtcttctaacttggagcgcttgattttccatctc
tttggcaatgacgctgcaaaaacagctgagctgatggaagccttgaacacagctggtcag
tatgacattcaaggggctgacgcggaaatcctctcgctctttgctgccgcctttgcgacg
gaagaagaaaccgctgcggaaatcaagcgtgtctatgacgagtcagactacattgaagat
ccacatacggctgttgcctcagctgtctataaacagtatgtggagcaaacaggggaccaa
actccgacagtgattgcttctacagcaagtccttacaagttccctgtggttgcggtagag
gcggtgacaggccagtcaggtttgtctgactttgaagcccttgcaaaattgcatgagatt
tcaggtgtagacttgccaccagctgtggacggcttggaaacggcacccgtccgccacaat
accgtcgttgcagctgccgatatgcagactgaagtagaacgctatttgggtgtttaa

DBGET integrated database retrieval system