KEGG   Streptococcus suis GZ1 (serotype 2): SSGZ1_0349Help
Entry
SSGZ1_0349        CDS       T02023                                 

Definition
(GenBank) Glycoside hydrolase, family 77
  KO
K00705  4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
ssw  Streptococcus suis GZ1 (serotype 2)
Pathway
ssw00500  Starch and sucrose metabolism
ssw01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ssw00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    SSGZ1_0349
Enzymes [BR:ssw01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     SSGZ1_0349
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_77
Motif
Other DBs
NCBI-ProteinID: ADE30814
UniProt: D5AG49
Position
376704..378212
Genome map
AA seq 502 aa AA seqDB search
MTNRTSGILMHITSLPGKFGIGTFGQSAYDFVDFLVETKQTYWQILPLTTTSYGDSPYQS
FSAIAGNTHLIDFDLLVEDGLLATEDFQDVNFGDNPEKVDYALIYQVRRPILEKAVQAFL
QDDKKKAAFLEFEKANSSWLTDYAEFMAIKEYFGNKALQEWEDKKVVARNEEALDKYRLE
LANQIDYYKVTQYFFFSQWKQLKEYANKHHIKIIGDMPIYVSADSVEVWTKPQLFKLDSE
RKPLYVAGVPADNFSADGQLWGNPIYDWPEHEKTGYNWWIYRIHESFKLYDVLRIDHFKG
FSDFWQVDGKAEVAKVGTWEPGPGYNLFKAVKETLGDLPIIAEDLGNIDAKARKLLADCG
YPGMKILEFGFFDVTGKSIDAPHRCIPNSVAYTGTHDNEVVNGWYNNLDPEQQEYVDAYS
NRKPIEKVSQAMLRMLFATVSDTAIATMQDVLDLGEESRMNMPSTIGGNWEWRMKAEDLT
QERKDFLTKMTLLYQRGNENHD
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atgacaaatcgtaccagtggaattttgatgcatattacctcacttccaggtaagtttggt
attggtacttttggacagtctgcctatgattttgtagatttcttggtggaaaccaagcaa
acctactggcagattttaccactaacaactacaagctatggagattctccttaccagtct
ttctctgctattgcaggaaatacacacttgatagactttgacctcttggttgaagatggc
ttattggcaacagaagatttccaagatgtaaattttggagataatcctgaaaaagtagac
tatgctcttatctatcaagttcgtcgaccaattttggagaaggcagttcaagcattttta
caagatgataagaagaaagctgcttttctagagtttgaaaaggctaactcatcttggttg
acagattatgcggagttcatggctatcaaggaatactttggtaataaagctctccaagaa
tgggaagataaaaaagttgtagctcgcaatgaggaagctcttgataagtaccgcttagaa
ttggcaaatcaaatcgactactacaaagtcacacagtatttcttcttcagccaatggaaa
caattgaaagaatatgccaacaaacaccacatcaaaatcatcggagatatgccaatctat
gtttctgctgatagcgttgaagtgtggacaaaaccccaactattcaaattggacagtgaa
cgcaagccgctttatgtagcaggtgtaccagctgataacttctcggcagatggtcaatta
tggggaaatcctatttacgattggccagaacatgaaaaaacaggctataactggtggatt
tatcgtatccatgaaagtttcaaactttatgatgtccttcggattgaccatttcaaaggt
ttctcagacttctggcaagttgatggtaaggcagaggtggcaaaagttggaacttgggaa
ccaggtcctggctacaatctcttcaaggctgtcaaagaaacacttggagaccttccaatc
attgcagaagaccttggaaacattgacgctaaagctcgcaaattgcttgcggattgtggc
tatccaggcatgaaaatcttagaatttggtttctttgatgtaacaggtaagagtatcgat
gctccacaccgttgcattccaaattcagttgcctacactggaactcacgataatgaggtt
gtcaatggctggtacaacaatcttgatccagaacaacaagaatacgtggatgcctacagc
aaccgtaagccgattgaaaaagttagccaagctatgctccgtatgctgtttgcaacagtg
agtgatacagctatcgcaaccatgcaagacgtcctagacttgggagaagaaagtcgaatg
aatatgccgtcaactatcggtggaaactgggaatggcgcatgaaagctgaagacttgacc
caagaacgcaaagacttcttgacaaaaatgacattactataccaacgaggaaatgaaaac
catgactaa

DBGET integrated database retrieval system