KEGG   Streptococcus suis GZ1 (serotype 2): SSGZ1_0522Help
Entry
SSGZ1_0522        CDS       T02023                                 

Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
ssw  Streptococcus suis GZ1 (serotype 2)
Pathway
ssw00010  Glycolysis / Gluconeogenesis
ssw00051  Fructose and mannose metabolism
ssw00562  Inositol phosphate metabolism
ssw01100  Metabolic pathways
ssw01110  Biosynthesis of secondary metabolites
ssw01120  Microbial metabolism in diverse environments
ssw01130  Biosynthesis of antibiotics
ssw01200  Carbon metabolism
ssw01230  Biosynthesis of amino acids
Module
ssw_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
ssw_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:ssw00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SSGZ1_0522
   00051 Fructose and mannose metabolism
    SSGZ1_0522
   00562 Inositol phosphate metabolism
    SSGZ1_0522
Enzymes [BR:ssw01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     SSGZ1_0522
Exosome [BR:ssw04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   SSGZ1_0522
  Exosomal proteins of bladder cancer cells
   SSGZ1_0522
  Exosomal proteins of melanoma cells
   SSGZ1_0522
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: ADE30987
UniProt: D5AGM2
Position
563797..564549
Genome map
AA seq 250 aa AA seqDB search
MSRKPIIAGNWKMNKNPQEAQAFVEAIAGKLPAGDKIEAAIAAPAVDLNALLWFAKDSEL
KVAAQNCYFEDAGAFTGETSPKVLAEMGVNYVVIGHSERRDYFYETDEDINKKAHAIFRN
GLTPIICCGESLETYEAGKAVEFVGAQVSAALKDLTAEQVASLVIAYEPIWAIGTGKSAT
KDDAQNMCKAVRDVVAADFGQEVADKVRVQYGGSVNPSNVAEYMACPDVDGALVGGASLE
AESFLALLNF
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgtcacgtaaaccaatcattgccggtaactggaaaatgaacaaaaatcctcaagaagca
caagcattcgttgaggctattgcaggaaaattgcctgcaggcgacaaaattgaagcagct
atcgcagcaccagctgtagatttgaatgctttgttgtggttcgctaaagattctgaattg
aaagttgctgctcaaaactgctactttgaagatgctggtgccttcactggtgaaacatct
ccaaaagtattggctgaaatgggtgttaactatgttgttatcggtcactcagagcgtcgt
gattacttctacgaaactgatgaagatattaataaaaaagctcatgcaatcttccgtaac
ggtttgactccaatcatctgttgtggtgagtcacttgaaacttacgaagctggtaaagcg
gttgaattcgtaggtgctcaagtttctgcagctttgaaagacttgactgctgaacaagta
gcatcacttgttattgcttacgagccaatctgggcaatcggtactggtaaatcagctact
aaagatgatgcacaaaacatgtgtaaagctgttcgggacgttgttgctgctgatttcggt
caagaagttgcagacaaagttcgcgttcaatacggtggttctgtaaacccatcaaacgtt
gctgaatacatggcatgtccagacgttgacggtgcgcttgttggtggtgcatcacttgaa
gcagaaagcttcttggctttgttgaacttctaa

DBGET integrated database retrieval system