KEGG   Streptococcus suis GZ1 (serotype 2): SSGZ1_1310Help
Entry
SSGZ1_1310        CDS       T02023                                 

Definition
(GenBank) rRNA (guanine-N(1)-)-methyltransferase
  KO
K00563  23S rRNA (guanine745-N1)-methyltransferase [EC:2.1.1.187]
Organism
ssw  Streptococcus suis GZ1 (serotype 2)
Brite
KEGG Orthology (KO) [BR:ssw00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:ssw03009]
    SSGZ1_1310
Enzymes [BR:ssw01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.187  23S rRNA (guanine745-N1)-methyltransferase
     SSGZ1_1310
Ribosome biogenesis [BR:ssw03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    SSGZ1_1310
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Methyltransf_25 Methyltransf_11 Methyltransf_31 Methyltransf_12 Methyltransf_23 MTS CMAS Methyltransf_9 Ubie_methyltran Methyltransf_32 FtsJ CpXC NodS DUF1726 MetW Methyltransf_29
Motif
Other DBs
NCBI-ProteinID: ADE31766
UniProt: D5AIV1
Position
complement(1362817..1363644)
Genome map
AA seq 275 aa AA seqDB search
MTKHQRFANSDQFFACPHCGQALGLDLNSLRCPNRHTFDIAKQGYVNLAPQVKQSANYHK
SSFENRQAFLEAGYYDHLYEALEEKIAELGLRSVLDIGCGEGFYSRKLAEKMDLDILAFD
ISKDSILLAARTDRTKSVKWFVGDLTKLPIQDKTIDGILDIFSPANYQEFARVLKAGGAI
LKLVPGPNHLKELRHLAKDQLRKESYDNQDIVDHFKSYMGQVEQEVVSRTLPIGIEQARI
LADMTPLFFQVDQSKLDLSQLTEITVEGLLLIGSI
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
atgaccaaacaccaacgttttgccaatagcgaccaatttttcgcctgtccacattgtggg
caggctcttggtcttgacctcaacagccttcgctgccccaaccgccacaccttcgacatt
gccaagcagggctacgtcaacctggcaccccaggtcaagcagtccgccaactaccacaag
tctagctttgaaaaccgtcaggcctttttagaggcgggctattacgatcatctctacgag
gctttggaggaaaaaatagcagagctgggattgcggtctgtcttggacatcggctgtgga
gagggcttttattcccgtaaattagccgagaaaatggacttggacattcttgcttttgat
atttctaaggattctattctcctagcagccagaacagacaggaccaagtcggtcaaatgg
tttgtcggtgacttgaccaagttgcccattcaagacaagaccatcgacgggatcttggac
atcttctccccagccaattatcaggaatttgccagagtgctgaaagctggtggggctatt
ctcaaactagttccaggccccaatcacctcaaggagctccgccatttagccaaagaccaa
ctccgcaaggagtcctatgacaaccaagatatcgtggaccatttcaagtcttacatggga
caggtggagcaagaggtggtcagccggaccctgccgattggtatagagcaggctcgtatt
ttggcagacatgacacccctctttttccaagtggaccagtccaagctggatttgagtcaa
ttgacggagataacggtggagggcttacttttgattggaagtatataa

DBGET integrated database retrieval system