KEGG   Streptococcus suis GZ1 (serotype 2): SSGZ1_1474Help
Entry
SSGZ1_1474        CDS       T02023                                 

Definition
(GenBank) Hydroxymethylglutaryl-CoA reductase
  KO
K00054  hydroxymethylglutaryl-CoA reductase [EC:1.1.1.88]
Organism
ssw  Streptococcus suis GZ1 (serotype 2)
Pathway
ssw00900  Terpenoid backbone biosynthesis
ssw01110  Biosynthesis of secondary metabolites
ssw01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:ssw00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    SSGZ1_1474
Enzymes [BR:ssw01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.88  hydroxymethylglutaryl-CoA reductase
     SSGZ1_1474
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HMG-CoA_red
Motif
Other DBs
NCBI-ProteinID: ADE31930
UniProt: D5AJB5
Position
1504104..1505384
Genome map
AA seq 426 aa AA seqDB search
MSTFSGFYKKSRQERIDILRQNRSLAEDSLDILYKDENLPEAIAGKMAENHLGTFSLPFS
VLPELLVDGQTYSVPMVTEEPSVVAAASFGAKIIAKSGGFTTTIHNRIMIGQVALYDISD
HSRATQAILDHKESILENANQAHPSIVKRGGGARELTVESKDEFLIVYLQVDVQEAMGAN
ILNNMLEAVKDDLEELSKGQALMGILSNYATESLITAQCHIAISSLATSSAIAQETAQKI
ALASKLAQVDPYRAATHNKGIFNGIDAVVIAAGNDWRAVEAGAHAYASRDGQYKGLSTWS
IDGEHLVGSITLPLPIASVGGSIGLNPKVAVAFDLLQQPKARQLASIIASVGLCQNFAAL
RALVTSGIQAGHMKLHAKSLALLAGAEEHEVDQLAQLLRKEKHSNLETAQNLLAKMREHW
EWERHP
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atgtcaactttttccggattttataaaaaatcacgccaagagcgcattgatattctccgt
cagaatcgttccctagccgaagatagcttagacattctatacaaagacgaaaacctgcca
gaagcaattgcgggaaagatggcagaaaatcatctaggaacgttttccttacctttttct
gtacttccagaacttctagtggatggacaaacttactctgtaccgatggttactgaagaa
ccttctgtggttgcagctgcatctttcggagccaaaatcatcgctaaatctggcggtttt
acaacgactattcacaaccgtatcatgattggacaagttgctctctacgatatttcggac
catagcagagcgacacaggcgattcttgaccataaggagagtattttagaaaatgccaat
caagcacacccttccattgtcaaacgagggggcggtgcaagagaattgactgttgagagt
aaggatgagtttttgattgtctatcttcaggttgatgtacaagaagccatgggagccaat
atcctcaataacatgttagaagctgttaaggatgacttagaagagctcagcaagggacag
gctttgatgggaatcctctccaactatgcaacggagtcactgatcaccgcccaatgccat
attgccatctctagtctggctaccagctctgccattgctcaagaaactgctcaaaaaata
gccctggcaagcaaactggcgcaagtggacccttatcgtgctgcgacacataacaaaggg
atttttaatggtatagatgctgtcgttatcgctgcaggaaatgactggcgggcagtcgaa
gccggagcccatgcttatgccagccgtgatggacaatacaaggggctttctacttggtct
attgatggcgagcacttggtcggctccatcaccctacctcttccgatcgcctccgtcggc
ggctcgatcgggctcaatccaaaggtagcagtcgcttttgaccttctccaacaaccaaag
gcacgccaattagcttctatcatcgcttctgtcggtctctgtcagaactttgctgccctg
cgtgctcttgttacttcagggattcaggctggtcacatgaagctccacgcaaaatcccta
gcgctacttgctggcgccgaggagcatgaagtagaccaactagcccaactcctgcggaaa
gaaaagcacagcaacctagaaactgctcaaaacttattagcaaaaatgagagaacattgg
gagtgggaaagacatccatga

DBGET integrated database retrieval system