KEGG   Streptomyces sp. SirexAA-E: SACTE_0512Help
Entry
SACTE_0512        CDS       T01601                                 

Definition
(GenBank) aromatic amino acid beta-eliminating lyase/threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
ssx  Streptomyces sp. SirexAA-E
Pathway
ssx00260  Glycine, serine and threonine metabolism
ssx01100  Metabolic pathways
ssx01110  Biosynthesis of secondary metabolites
ssx01120  Microbial metabolism in diverse environments
ssx01130  Biosynthesis of antibiotics
ssx01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ssx00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SACTE_0512
Enzymes [BR:ssx01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     SACTE_0512
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase Aminotran_5 Glyco_hydro_20 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: AEN08452
UniProt: G2NGU9
Position
complement(571130..572194)
Genome map
AA seq 354 aa AA seqDB search
MRTDARRHHDPQVRGFASDNYAGAHPEILAALALANGGHQVAYGEDDYTGHLQRVMHSHF
GPTAEAFPVFNGTGANVVALQALTDRWGAVICAESAHINVDEGGAPERMGGLKLLTVQTP
GGKLTPELIDRQAYGWDDEHRAMPQVVSITQNTELGTVYTPDEIRAICDHAHERGMKVHL
DGARIANAAASLDVPMRAFTTVAGVDVLSFGGTKNGALFGEAVVVLEPDSVRAMKHLRKL
SMQLASKMRFVSVQLEALLARDLWLRNARHANAMARRLAEGVGAVDGVEILYPVQANAVF
ARLPHDVSERLQKRFRFYFWDETAGDVRWMCAFDTREEDVDAFVQALKEEMASS
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
gtgaggaccgacgcgcgacggcaccacgatccgcaggtacgcggtttcgccagtgacaac
tacgcgggcgcgcacccggagatcctcgcggccctcgccctcgccaacggcggacaccag
gtcgcctacggcgaggacgactacaccggccacctgcagcgggtcatgcacagccacttc
gggcccaccgccgaggccttccccgtcttcaacggcaccggtgccaacgtcgtcgccctc
caggcgctgaccgaccgctggggcgccgtgatctgcgccgagtccgcgcacatcaacgtg
gacgagggcggggcgccggagcggatgggcgggctgaagctgctcaccgtgcagaccccg
ggcgggaagctgacgccggagctcatcgaccgccaggcgtacggctgggacgacgagcac
cgggcgatgccccaggtcgtctccatcacccagaacaccgagctgggcacggtctacacc
cccgacgagatccgggcgatctgcgaccacgcccacgagcgcgggatgaaggtgcacctg
gacggagcgcggatagccaacgccgcagcgtcgctggacgtcccgatgcgggcgttcacc
accgtggccggcgtcgacgtcctctccttcggcggcacgaagaacggcgcgctcttcggt
gaggccgtcgtcgtcctggaaccggactccgtccgcgccatgaagcacctgcgcaagctg
tcgatgcagctcgcctccaagatgcggttcgtctccgtccagctggaggccctgctcgcc
cgcgacctctggctgcgcaacgcccgccacgccaacgccatggcgcggcggctcgccgag
ggcgtcggcgcggtggacggggtggagatcctctacccggtgcaggccaacgccgtcttc
gcccggctgccgcacgacgtctccgagcggctgcagaagcgcttcaggttctacttctgg
gacgagacggccggggacgtgcgctggatgtgcgccttcgacacccgcgaggaggacgtc
gacgcgttcgtgcaggcgctcaaggaggagatggcctcctcgtag

DBGET integrated database retrieval system