KEGG   Streptomyces sp. SirexAA-E: SACTE_1311Help
Entry
SACTE_1311        CDS       T01601                                 

Definition
(GenBank) Pectinesterase
  KO
K01051  pectinesterase [EC:3.1.1.11]
Organism
ssx  Streptomyces sp. SirexAA-E
Pathway
ssx00040  Pentose and glucuronate interconversions
ssx01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ssx00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    SACTE_1311
Enzymes [BR:ssx01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.11  pectinesterase
     SACTE_1311
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pectinesterase Pectate_lyase_3
Motif
Other DBs
NCBI-ProteinID: AEN09231
UniProt: G2NGX7
Position
complement(1471543..1472640)
Genome map
AA seq 365 aa AA seqDB search
MTSRRSALSLLAGAGAALAVGAPSAHARAARPRPFGRHGSPARRLDARTLYVDPHGRGDH
TDVRSALDAATGSGRTLVIAPGTYRGPVTVPADRAGLTLIGASGDARDTVLVHDNAAGTP
KPDGSGTLGTSGSATVTVQAAGLTVRDVTFSNDWLRSDNPEYTGTQAVAIKVQGDRSAFY
GCRFLGHQDTLYADSLSLTAFARQYYRDCYVEGDVDFVFGRATAVYDRCHFRTLTRTDLA
SAPYGFVFAPSTAGANPHGFLVLRSRVTSTAPDAYYKLARPWVPSSDLTAHPMLTVRDTY
LGPGIDAVTPYADMSADFPWQEQRFAEHRNTGPGARVTAPADRPQLSASEARAHTPAGWL
GDWRP
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atgaccagcagacgcagtgccctctccctgctcgcgggcgcgggcgccgccctcgccgtc
ggcgccccctccgcccacgcccgggccgcccgcccccgccccttcggccgccacggttca
ccggcccgccgcctcgacgcccgcacgctgtacgtcgatccgcacggcaggggcgaccac
accgacgtacggtcggccctcgacgccgccaccggcagcggccgcaccctggtgatcgcc
cccggcacctaccgcggccccgtcaccgtgcccgccgaccgggcgggcctcaccctgatc
ggcgcgagcggcgacgcccgcgacaccgtcctggtccacgacaacgcggccggcacgccc
aagcccgacggctccggcaccctgggtaccagcggttcggccaccgtcaccgtccaggcc
gccggcctcaccgtccgcgacgtgaccttctccaacgactggctgcgctccgacaacccg
gagtacaccggcacccaggccgtcgcgatcaaggtccagggcgaccgctcggcgttctac
ggctgccgcttcctcggccaccaggacaccctgtacgccgactccctctcgctgaccgcg
ttcgcccgccagtactaccgcgactgctacgtggagggcgacgtcgacttcgtgttcggc
cgcgccaccgccgtctacgaccgctgccacttccgcaccctgacccgcaccgacctcgcc
tcggccccgtacggcttcgtcttcgcgcccagcaccgccggggccaacccgcacggcttc
ctggtgctgcgttcccgcgtcaccagcaccgcccccgacgcgtactacaagctggcccgc
ccctgggtgccgtcctccgacctcacggcccacccgatgctgaccgtccgcgacacgtac
ctgggcccgggcatcgacgcggtcaccccgtacgccgacatgtcggccgacttcccgtgg
caggaacagcgcttcgccgaacaccgcaacaccggccccggcgcccgcgtcaccgccccc
gccgaccggccgcagctcagcgcgtcggaagcacgcgcgcacaccccggccggctggctg
ggggactggcgcccgtag

DBGET integrated database retrieval system