KEGG   Streptomyces sp. SirexAA-E: SACTE_1461Help
Entry
SACTE_1461        CDS       T01601                                 

Definition
(GenBank) tryptophan synthase, alpha subunit
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
ssx  Streptomyces sp. SirexAA-E
Pathway
ssx00260  Glycine, serine and threonine metabolism
ssx00400  Phenylalanine, tyrosine and tryptophan biosynthesis
ssx01100  Metabolic pathways
ssx01110  Biosynthesis of secondary metabolites
ssx01130  Biosynthesis of antibiotics
ssx01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ssx00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SACTE_1461
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SACTE_1461
Enzymes [BR:ssx01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     SACTE_1461
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA BtpA PcrB His_biosynth
Motif
Other DBs
NCBI-ProteinID: AEN09378
UniProt: G2NBJ7
Position
complement(1638619..1639434)
Genome map
AA seq 271 aa AA seqDB search
MSGNRELLSTTLAKAASEDRAALIAYLPGGFPTVDGGIAAVKAAVAGGADVIEVGLPHSD
PVLDGPVIQTADDIALRGGVRIADIMRTVREAYEATGTPILVMTYWNPIDRYGVERFTAE
LAEAGGAGCILPDLPVQESALWREHAEKHSLATVFVVAPSSKDERLAEITAAGSGFVYAS
SLMGVTGTRESVGEQAQELVRRTRATRGELPVCVGIGVSTREHARQVAGFADGVIVGSAF
VKRMLDAPDEAAGLEAVRALAGELAEGVRKR
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
gtgagcggcaaccgggaactgctgagtacgaccctggcgaaggcggcctccgaggacagg
gcggcgctcatcgcctacctgcccggcggcttcccgaccgtcgacggcggcatcgcggcg
gtcaaggccgccgtcgcgggcggcgccgacgtcatcgaggtgggcctgccgcacagcgac
ccggtgctcgacggaccggtcatccagaccgccgacgacatcgcgctgcgcggcggcgtc
aggatcgccgacatcatgcgcaccgtccgggaggcgtacgaggcgacggggaccccgatc
ctcgtcatgacgtactggaacccgatcgaccgctacggcgtggaacgcttcaccgccgag
ctcgccgaggcgggcggcgccgggtgcatcctgcccgacctgcccgtccaggagtccgcg
ctgtggcgcgagcacgccgagaagcactccctggccaccgtcttcgtcgtcgcgccgagc
agcaaggacgagcggctcgcggagatcacggccgccggctccggcttcgtctacgcctcg
tccctgatgggcgtcaccggtacccgggagtccgtcggcgagcaggcccaggagctcgtg
cggcgcacccgcgccaccaggggcgagctgcccgtctgcgtcggcatcggggtctccacc
cgcgagcacgcacgacaggtcgcgggcttcgccgacggggtgatcgtcggctcggccttc
gtcaagcggatgctggacgcgccggacgaggccgcgggcctggaagccgtccgcgcgctg
gcgggcgaactcgccgaaggtgttcgaaagcgctga

DBGET integrated database retrieval system