KEGG   Streptomyces sp. SirexAA-E: SACTE_2271
Entry
SACTE_2271        CDS       T01601                                 

Definition
(GenBank) pyruvate carboxyltransferase
  KO
K01640  hydroxymethylglutaryl-CoA lyase [EC:4.1.3.4]
Organism
ssx  Streptomyces sp. SirexAA-E
Pathway
ssx00072  Synthesis and degradation of ketone bodies
ssx00280  Valine, leucine and isoleucine degradation
ssx00281  Geraniol degradation
ssx00650  Butanoate metabolism
ssx01100  Metabolic pathways
ssx01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ssx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    SACTE_2271
  09103 Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    SACTE_2271
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SACTE_2271
  09109 Metabolism of terpenoids and polyketides
   00281 Geraniol degradation
    SACTE_2271
Enzymes [BR:ssx01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.4  hydroxymethylglutaryl-CoA lyase
     SACTE_2271
SSDB
Motif
Pfam: HMGL-like
Other DBs
NCBI-ProteinID: AEN10163
UniProt: G2NE75
Position
2541693..2542670
AA seq 325 aa
MTGIEEDGAIGATALPMTVPLPGLPARVRIHEVGARDGLQNEASVVPTEVKAQFIRRLAE
AGLTTIEATSFVHPKWVPQLADAERLFPLLGEIADVGDVELPVLVPNERGLDRALALGAR
RIAVFGSATETFAARNLNRTVDESLAMFEPVVARATAEGVGVRGYLSMCFGDPWEGAVPL
GQVVRVAKALMDLGCDELSLGDTIGVATPGQVVALLAALNDAGVPTASIGVHFHDTYGQA
LSNTLAALQQGVTTVDASAGGLGGCPYAKSATGNLATEDLVWMLDGLGVDTGVDLGALTA
TSVWMAEQLGRPSPSRTVRALTHKE
NT seq 978 nt   +upstreamnt  +downstreamnt
atgaccggcatcgaggaagacggcgcgatcggcgccaccgcactgcccatgaccgtgccc
cttccggggctgcccgcccgggtccgcatccacgaggtcggagcccgcgacggcctgcag
aacgaggcgtcggtcgtcccgaccgaggtgaaggcccagttcatccgccggctcgcggaa
gccgggctcaccacgatcgaggccaccagcttcgtgcacccgaagtgggtgccccagctg
gccgacgcggagcggctgttcccgctgctcggcgagatcgcggacgtcggggacgtcgag
ctccccgtcctcgtaccgaacgaacgcggtctggaccgggcgctggcgctcggtgcccgc
cggatcgcggtgttcggctcggcgaccgagacgttcgccgcccgcaacctcaaccgcacg
gtggacgagtcgctggccatgttcgagccggtggtcgcccgcgccacggcggagggggtg
ggggtgcgcggctatctgtcgatgtgcttcggcgacccctgggaaggggccgtcccgctc
gggcaggtcgtgcgggtcgcgaaggcgctcatggacctcggctgcgacgagctctccctg
ggcgacacgatcggtgtggcgacgcccggtcaggtggtggccctgctcgccgcgctgaac
gacgcgggtgtgcccaccgcctcgatcggggtgcacttccacgacacgtacggccaggcc
ctctccaacaccctggccgcgctccagcagggggtgacgacggtggacgcctcggcgggc
ggcctcggcggctgcccgtacgcgaagagcgcgaccggaaatctcgccaccgaggatctc
gtgtggatgctcgacggcctcggtgtcgacaccggggtcgatctcggcgcactcaccgcc
acgagcgtgtggatggccgaacagctgggccggcccagcccgtcccgtaccgtccgcgcc
ctgactcacaaggagtga

DBGET integrated database retrieval system