KEGG   Streptomyces sp. SirexAA-E: SACTE_2436Help
Entry
SACTE_2436        CDS       T01601                                 

Definition
(GenBank) Uroporphyrinogen III synthase HEM4
  KO
K01719  uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
ssx  Streptomyces sp. SirexAA-E
Pathway
ssx00860  Porphyrin and chlorophyll metabolism
ssx01100  Metabolic pathways
ssx01110  Biosynthesis of secondary metabolites
ssx01120  Microbial metabolism in diverse environments
Module
ssx_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:ssx00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    SACTE_2436
Enzymes [BR:ssx01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     SACTE_2436
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEM4 Trans_reg_C
Motif
Other DBs
NCBI-ProteinID: AEN10324
UniProt: G2NKW9
Position
complement(2720428..2721573)
Genome map
AA seq 381 aa AA seqDB search
MHDDDAQHGPLAGFTVGVTAARRAEELGTLLTRRGAAVLHAPALRIVPLADDSELLAATE
ELLDDVPDVVIATTAIGFRGWVEAADGWGIGDRLLEVLRGGELLARGPKVKGAIRAAGLT
EAWSPGSESMAEVLDRLLGEGVEGRRIALQLHGEPLPGFVDALREAGAEVVGVPVYRWMP
PQDIAPLDRMLDVTVARGLDALTFTSAPAAASYLNRAESRGMLPQVLSALGHDVVVACVG
PVTALPLQARGIDTVQPERFRLGPLVQLLCAHLPARARALPVAGHLVEIRGHAVLVDRAL
HPVPPAGMALLHALARRPGWVVSRADLLRALPGSGTDEHAVETAMARLRTVLGAPELIQT
VVKRGYRLALDPAADTRYDGP
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
atgcacgacgacgacgcacagcacgggcctctcgcgggcttcacggtcggggtgaccgca
gcccgtcgcgccgaggagctggggacgctcctcacgcgccggggcgccgcggtcctgcac
gcgccagcgctgcggatcgtgcctctcgcggacgacagcgaactcctcgccgccaccgag
gaactgctcgacgacgtgcccgacgtggtgatcgccaccaccgccatcgggttccgcggc
tgggtcgaggccgccgacggctggggcatcggcgaccggctgctggaggtgctgcgcggg
ggcgaactgctggcccgggggcccaaggtcaagggcgccatccgggccgccgggctcacc
gaggcgtggtcgcccgggtcggagtccatggcggaggtcctggaccggctgctgggcgag
ggcgtcgaagggcggcggatcgccctccaactgcacggcgaacccctgcccggcttcgtc
gatgcgctccgggaggcgggggcagaggtcgtcggcgtcccggtctaccggtggatgccc
ccgcaggacatcgcccccctcgaccggatgctggacgtcacggtggcccgcggcctggac
gccctgaccttcaccagcgcccccgccgccgcctcgtacctgaaccgggcggagtcgcgc
ggcatgctcccccaggtgctgtccgcactgggccacgacgtcgtcgtggcctgcgtcggc
ccggtcaccgcgctgcccctccaggcccggggcatcgacaccgtccagccggaacgcttc
cggctcggcccgctcgtccaactgctctgcgcccatctgcccgcacgcgcccgggccctg
ccggtcgccggacacctggtcgagatccgggggcacgccgtcctggtcgacagggcgctg
cacccggtgccgcccgccggcatggccctgctgcacgcgctcgcccgccggccgggctgg
gtggtctcccgcgccgacctgctgcgcgcgctgcccggcagcggcaccgacgagcacgcc
gtggagacggcgatggcccggctgcgtacggtgctcggggcgcccgagctgatccagacc
gtcgtcaagcgcggctaccggctcgccctggaccccgcggcggacaccaggtacgacggc
ccctga

DBGET integrated database retrieval system