KEGG   Streptomyces sp. SirexAA-E: SACTE_2578Help
Entry
SACTE_2578        CDS       T01601                                 

Definition
(GenBank) conserved hypothetical protein
Organism
ssx  Streptomyces sp. SirexAA-E
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SUKH-4 XOO_2897-deam
Motif
Other DBs
NCBI-ProteinID: AEN10465
UniProt: G2NEF6
Position
complement(2910403..2912829)
Genome map
AA seq 808 aa AA seqDB search
MVTFAQAQERADEWVNGDVPGYQHREVRVREFELGFVVWAEDRADGPVSDGGRQRLVIAR
DSGEATLWPGLPVGEVIRRYEEEYGVAEAAAAAPEPPQRIDLNQTSFLLSPPEWLQEAAD
KLGIPDRRAEPGPGVPAQAPGSDSVDAPPVAAGASAWPVAGGGDEDHEPTASDGVPAGAT
PWAGTDTNAGSDEGEVGLPATVFAPPLSGSDDDGTPPPSVPAEAPTALMSGGSGLPRTAV
VPELDPQAGGGTPPPGAPAAGGTPPPGAPSGPAAGDIADAATSKAVVPPRGARGSGPTTP
PPPGAPGTPGARPGSAVPPPPAPGTGAPDGPAGGYVPTQLVSQLGPSGDTGAPGAPPGPP
APPAPPGATPPPGGGVHHAATVFADASLGGANTPRPPGPPPGAPQPPGPPGPPAPPGPPG
PPAPPGATPPPGGGVHHAATMLAGSARTGPGAPQPPGPPGPPGVPAGPHTPPPPAYGYPQ
QPAGQPTVGPGYQAVLRFRAPDGSEQQLIRRSAPGTPHPEWQMLHELRAMNVPPQQVIEL
HTELESCELPGAYCARMIREMWPQVRITSVAPYGTDHASRQQGMQALLTHQGELHQVADG
PARPAPVRAPLPQVAPAAPVPPEALAEEMLGAFGPQGVLRFDQRAVSRQGVPEEVARTLV
WAGLPADFGPFFWAQPGQPVVPTLGELAAQRQVQPAPDAGSYLVMGSDFGRAVCVQYGTA
NIVAVPVEAGPGGQAVPPQFVNTGLAEFVRSMALLGRMWRLRYGLNPEQAGRWTVDFQAQ
LAALDPAALASPESWWSVLLEQMWDGLL
NT seq 2427 nt NT seq  +upstreamnt  +downstreamnt
atggtgacgttcgcgcaggcgcaggagcgggccgacgagtgggtcaacggtgatgtgccg
ggctatcagcaccgtgaggtgcgggtccgtgagttcgagctgggtttcgtggtgtgggcc
gaggaccgggcggacggtcccgtgtcggacggtggccgccagcggttggtgatcgcccgg
gacagtggtgaggccacgttgtggccggggttgccggtgggtgaggtgatccggcggtac
gaggaggagtacggggtggccgaggcggctgcggccgctccggagccgccgcagcgtatc
gatctgaatcagacgtcgttcctgttgagtcctccggagtggctccaggaggcggcggac
aagctggggatcccggaccggcgtgccgagccgggtccgggggtgccggcgcaggcgccc
ggttccgattccgtggacgcgccgccggtggccgcgggggcgtcggcgtggccggtggcc
ggtggcggggacgaggaccacgagccgacggcgtcggacggtgtgccggccggggcgacg
ccttgggcgggtacggacacgaacgcgggctcggacgagggtgaggtggggttgccggcg
acggtgttcgcgccgccgctgtccgggtcggacgacgacgggactccgcctccgagcgtg
ccggccgaggctccgaccgcgctgatgtcgggtgggagcgggctgccgaggacggcggtc
gtaccggagctcgatccgcaggcgggtgggggtactccgcctcccggggcacctgccgcc
gggggtactccgcctcctggggcaccttcgggtccggcggccggtgacatcgcggacgcg
gccaccagcaaggccgtggtgccgccgcgcggtgcgcggggatcgggtccgacgactccg
ccgccgccgggtgcgcccggtacgccgggggcgcgtccggggtccgctgtgccgccgccg
cccgccccggggacgggtgccccggacgggccggcgggtggttacgtaccgacgcagttg
gtgtcgcagctcgggccgtcgggggacacgggtgccccgggtgcgcctccgggtccgccc
gcgcccccggctcctcccggggcgacgccgccgcccggtggcggggtgcatcacgccgcg
acggtgttcgccgacgcgagcctgggcggcgcgaacacgccgcggcctccggggccgccg
cccggggctccgcagcctcccgggcctccggggccgcccgcgccccccgggcctcccggt
ccgccggctcctcccggggcgacgccgccgcccggtggcggggtgcaccacgccgcgacg
atgctggccggttccgcccggacgggtccgggcgcgccgcagccccccgggccgccgggt
cctcccggggtaccggccggtccgcacacgccgccgcccccggcgtacggctatccgcag
cagccggccgggcagccgacggtcggtcccgggtatcaggcggtgctgcggttccgggcg
cccgacggcagtgagcagcagctgatccgccggtccgcgccgggcaccccgcacccggag
tggcagatgctgcacgagttgcgggcgatgaacgtgccgccgcagcaggtcatcgagctg
cacacggagctggagtcgtgcgagctgccgggcgcctactgcgcgcggatgatccgggag
atgtggccgcaggtccggatcacgagtgtcgctccgtacggcaccgatcacgcgagccgg
cagcagggcatgcaggcgctgctgacgcatcagggtgagctgcaccaggtggcggacggt
ccggcgcgtccggctccggtgcgtgcgccgcttccgcaggtcgcgcccgccgctccggtg
ccgccggaggcgctggcggaggagatgctgggggcgttcggcccgcagggtgtgctccgg
ttcgaccagcgggcggtgtcccgtcagggtgtgccggaggaagtggcgcggaccttggtg
tgggcgggtctgcccgccgacttcgggccgttcttctgggcgcagccgggtcagccggtg
gtgccgacgctgggtgagctggcggcgcagcgtcaggtgcagccggctccggacgcgggt
tcgtatctggtgatggggtcggacttcggccgggcggtctgtgtgcagtacggcacggcg
aacatcgtggcggtgccggtggaggcggggccgggcgggcaggcggtgccgccgcagttc
gtgaacaccgggctggcggagttcgtgcggtcgatggctttgctgggccggatgtggcgg
ctgcggtacgggctcaatccggagcaggcgggccgttggaccgtcgatttccaggcgcag
ttggcggcgttggatccggcggcgctggcgtctccggagagctggtggtcggtcctgctg
gagcagatgtgggacgggctgttgtga

DBGET integrated database retrieval system