KEGG   Streptomyces sp. SirexAA-E: SACTE_2586Help
Entry
SACTE_2586        CDS       T01601                                 

Definition
(GenBank) ribosomal 5S rRNA E-loop binding protein Ctc/L25/TL5
  KO
K02897  large subunit ribosomal protein L25
Organism
ssx  Streptomyces sp. SirexAA-E
Pathway
ssx03010  Ribosome
Module
ssx_M00178  Ribosome, bacteria
Brite
KEGG Orthology (KO) [BR:ssx00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    SACTE_2586
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:ssx03011]
    SACTE_2586
Ribosome [BR:ssx03011]
 Ribosomal Proteins
  Bacteria
   Large subunit
    SACTE_2586
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L25p Ribosomal_TL5_C
Motif
Other DBs
NCBI-ProteinID: AEN10473
UniProt: G2NEG4
Position
2920405..2920989
Genome map
AA seq 194 aa AA seqDB search
MAEIKLATEVRTEFGKGAARRIRRANQVPGVVYGHGAEPVHVTLPGHDLLLALRTPNVLI
GLEIDGKDALVIPKAVQRNAIKGDIEHVDLLTVKRGEKVNVEVAVHAEGDLAPGANLLEF
VMNTLLVEAEATHIPESVTVSVAGLDAGASVLAKDIPLPSGSVLAEDPEAVVLAVVAAQS
EPASDEAAAEGEEA
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
atggccgagatcaagctcgccaccgaggtccgtaccgagttcggcaagggcgccgcccgc
cgtatccgtcgggccaaccaggttcccggtgtggtctacggccacggcgccgagccggtc
cacgtcacgctgccgggtcacgacctgctgctggcgctgcgtacgccgaacgtcctgatc
ggtctggagatcgacggcaaggacgccctggtcatcccgaaggccgtccagcgcaacgcc
atcaagggcgacatcgagcacgtcgacctgctgaccgtgaagcgcggcgagaaggtcaac
gtcgaggtcgcggtgcacgccgagggcgacctggcgccgggtgcgaacctgctcgagttc
gtgatgaacacgctgctcgtcgaggccgaggccacccacatccccgagtcggtcacggtc
tccgtggcgggcctggacgccggtgcgtcggtgctggcgaaggacatcccgctgccgtcc
ggttcggtgctggccgaggacccggaggccgtcgtgctggccgtcgtggccgcgcagtcc
gagccggcgtccgacgaggccgccgccgagggcgaagaggcctga

DBGET integrated database retrieval system