KEGG   Streptomyces sp. SirexAA-E: SACTE_2596Help
Entry
SACTE_2596        CDS       T01601                                 

Definition
(GenBank) GCN5-related N-acetyltransferase
Organism
ssx  Streptomyces sp. SirexAA-E
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acetyltransf_1 Acetyltransf_10 Acetyltransf_7
Motif
Other DBs
NCBI-ProteinID: AEN10482
UniProt: G2NEH3
Position
2929803..2930321
Genome map
AA seq 172 aa AA seqDB search
MFRLETEVDKERRLLLGRRLHDANWDGSSGLRALRSTSAENEIPLDVWLLDEDGALAGGL
SGRTWAYWLHVDLLWVDARHRGAGHGARLLAEAERVAREDRACTRSRLETWDFQAPAFYR
KHGYEVAGEVEDYPPGVHEFILVKRLVRPETAAGRRPRGLRGRFLGRRTRPR
NT seq 519 nt NT seq  +upstreamnt  +downstreamnt
atgttccgtcttgagacagaagtggacaaggaacgtcgtcttctgctgggccgtcggctg
cacgacgccaactgggacggatcatccggcctgcgggccctgcgctccacttccgccgag
aacgaaatccccctggatgtctggctcctggacgaggacggcgccctggccggcgggctg
tccgggcgcacctgggcgtactggctccatgtggacctgctctgggtcgacgcccgccac
cgcggcgcgggccacggcgcccggctcctcgccgaggcggagcgcgtcgcccgcgaggac
cgggcctgtacccgctcccggctggagacctgggacttccaggcccccgccttctaccgg
aagcacgggtacgaggtggccggtgaggtcgaggactacccgccgggcgtccacgagttc
atcctggtcaaacggctggtacggccggagacagccgccgggcgccggccgaggggactg
cggggaagattcctggggcggcgtacccggccgaggtga

DBGET integrated database retrieval system