KEGG   Streptomyces sp. SirexAA-E: SACTE_2606Help
Entry
SACTE_2606        CDS       T01601                                 

Definition
(GenBank) two component transcriptional regulator, LuxR family
Organism
ssx  Streptomyces sp. SirexAA-E
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GerE Response_reg Sigma70_r4_2 Sigma70_r4 HTH_10
Motif
Other DBs
NCBI-ProteinID: AEN10492
UniProt: G2NEI3
Position
complement(2938491..2939183)
Genome map
AA seq 230 aa AA seqDB search
MGVRLMVVDDHRLLAEALASALKLRGHRVLAAAAPTAGAAELVVSRAPEVCLFGTAVPAE
PGVFDPIVRIGRERPQVAVVVLGPVPSPRGIAAAFAAGAAGYVRHDERIEGVERAMAKAR
AGEAAVAPQLLRGAFAELLHPAVQPDDEGQRLLRMLTPREVEVLLRVAEGEDTRLIAAGM
GIASSTARTHVQRVLMKLGVGSRLEAAALAARTGLLDRAAGAAKGPDRPA
NT seq 693 nt NT seq  +upstreamnt  +downstreamnt
atgggtgtgcggctcatggtggtcgacgaccaccgtctgctcgccgaggcgctcgcctcg
gcactgaaactgcgcgggcaccgggtgctcgccgccgccgcgccgaccgccggggccgcc
gaactggtggtcagccgggccccggaggtctgtctcttcggtacggcggtaccggccgaa
cccggcgtgttcgaccccatcgtgcggatcggtcgggagcgcccccaggtggccgtggtc
gtgctcggcccggtgccgagcccgcgggggatcgccgcggccttcgccgccggggcggcg
gggtacgtccgccacgacgagcgcatcgagggcgtcgaacgcgccatggccaaggcccgc
gcgggcgaggccgccgtcgccccgcaactgctgcgcggcgccttcgcggagctgctccac
ccggcggtccagcccgacgacgagggccagcggctgctgcggatgctcaccccgcgcgag
gtggaggtgctgctacgggtcgccgagggcgaggacacccggctcatcgcggccgggatg
gggatcgcctccagcaccgcgcgtacccatgtgcagcgggtcctgatgaagctgggcgtc
ggctcccggctggaggcggcggccctcgccgcccgcacgggcctgctggaccgggcggcc
ggagcagcgaaggggccggaccgccccgcgtga

DBGET integrated database retrieval system