KEGG   Streptomyces sp. SirexAA-E: SACTE_2612Help
Entry
SACTE_2612        CDS       T01601                                 

Definition
(GenBank) 4-diphosphocytidyl-2C-methyl-D-erythritol kinase
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
ssx  Streptomyces sp. SirexAA-E
Pathway
ssx00900  Terpenoid backbone biosynthesis
ssx01100  Metabolic pathways
ssx01110  Biosynthesis of secondary metabolites
ssx01130  Biosynthesis of antibiotics
Module
ssx_M00096  C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:ssx00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    SACTE_2612
Enzymes [BR:ssx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     SACTE_2612
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_C GHMP_kinases_N
Motif
Other DBs
NCBI-ProteinID: AEN10498
UniProt: G2NEI9
Position
complement(2948162..2949055)
Genome map
AA seq 297 aa AA seqDB search
MSVTVRVPAKVNVRLAVGAARPDGFHDLANVFLAVGLYDEVTAAPADTLRVTCTGPDAAQ
VPLDATNLAARAAVALAERHGISPDVHLHIAKDIPVAGGMAGGSADGAAALVACDALWST
GASQDELLAICAELGSDVPFSLIGGAALGVGRGEQLTPIEVGGTFHWVFAVADGGLSTPA
VYAEFDRLTAGTQVPEPTASPALLAALRKGDTTALADALGNDLQAAALSLRPSLADTLAA
GTAAGALAALVSGSGPTTAFLAADADAARTIADALAASGTCRSARVAVSPAPGATVC
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgagcgtcaccgtccgcgtccccgccaaggtcaacgtgcggctcgccgtcggagcggcg
cgccccgacggcttccacgacctggccaacgtgttcctcgccgtcggactgtacgacgag
gtcaccgccgcccccgccgacaccctgcgcgtcacctgcaccggcccggacgccgcacag
gtcccgctggacgccaccaacctggcggcccgcgccgccgtcgcgctggccgaacgccac
ggcatcagccccgacgtgcacctccacatcgccaaggacatccccgtcgccggaggcatg
gcgggcggcagcgcagacggcgcggccgctctggtggcctgcgacgccctgtggtcgacc
ggagcctctcaggacgaactgctcgccatctgcgcagagttgggcagcgatgtgccgttc
agcctgatcggcggggccgcgctcggcgtcggccggggggaacagctgacccccatcgag
gtcggcggcaccttccactgggtcttcgccgtcgccgacggcggactctccaccccggcg
gtctacgctgagttcgaccggctcaccgcgggcacccaggtccccgaacccaccgcgtcc
cccgcgctcctggccgccctgcgcaagggtgacaccacggccctcgcggacgccctcggc
aacgacctccaggccgccgctctctctctgcgcccctcgctcgccgacaccctcgccgcc
ggcaccgccgcgggcgccctggccgcgctggtctcgggatcgggaccgaccacggcgttc
ctggccgccgacgcggacgcggcccggacgatcgccgacgcgctggcggcctcgggcacc
tgccgcagcgcgcgcgtggccgtctccccggcaccgggggccacggtgtgctag

DBGET integrated database retrieval system