KEGG   Streptomyces sp. SirexAA-E: SACTE_2627Help
Entry
SACTE_2627        CDS       T01601                                 

Definition
(GenBank) MMPL domain protein
  KO
K06994  putative drug exporter of the RND superfamily
Organism
ssx  Streptomyces sp. SirexAA-E
Brite
KEGG Orthology (KO) [BR:ssx00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99996 General function prediction only
    SACTE_2627
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MMPL
Motif
Other DBs
NCBI-ProteinID: AEN10513
UniProt: G2NHS7
Position
complement(2963456..2965675)
Genome map
AA seq 739 aa AA seqDB search
MATFLYKVGRLAFRRRWYVALVWVALLGLAGFGAASASTATSSSFSIPGTEAQKAFDLLE
ERFPGGSADGATARVVFKAPEGEKMTDADNRADVRKIVGTLESGSDQIASVADPYTANAV
SEDGSTAYISVSYKVNSMELTDATRDSLEHAGEAARSDGLTVEIGGDALQVMPETGVTEV
IGVAIAAVVLVITFGSLIAAGLPLLTALIGVGIGVSLITALANVLDLGSTTSTLAMMIGL
AVGIDYALFIVSRYRAELAEGREREEAAGRAVGTAGSAVVFAGLTVVIALVGLAVVNIPM
LSKMGFAAAGTVAIAVLIALTLVPALLGVAGKQVMGRKARKAADAENKPDAKPNMGTRWA
RFVLRKPVWVLLAGVVGLGVIAVPAASLEMGLPDDGSQPRSTTQRQAYDLLSDGFGPGFN
GPLLVVVDTRNSSDGKTAVAQVSQGIEASGHVAAVTPATFNKAGDAATITVIPKDRPSST
DTENVVHAIRDAGADIKSETGAEVLVTGATAMNIDFSEKMNDALLPYLALVVGLAFLLLM
VVFRSLLVPLKAALGFLLSVVAALGAVVAVFQWGWLASLFGVEQTGPIMSMMPIFMVGVV
FGLAMDYEVFLVTRMREAYVHGETPGQAIVTGFRHGARVVTAAAVIMMAVFAGFIGSSES
MIKMIGFSLAIAVFFDAFVVRMAIVPAVLALLGRRAWWLPRWLDRALPSVDVEGEGLRTE
PAADGPGEGPGGERELSRV
NT seq 2220 nt NT seq  +upstreamnt  +downstreamnt
gtggccacatttctctataaagtcggacggctcgccttccggcgccgctggtacgtcgcc
ctggtctgggtggcgctgctggggctcgccggattcggggccgcctccgcgtccaccgcc
acctccagttccttctcgatccccggcacggaggcccagaaggccttcgacctgctggaa
gagcgcttccccggcggcagtgccgacggtgcgaccgcgcgggtcgtcttcaaggccccc
gagggcgagaagatgacggacgcggacaacagggcggacgtccgcaagatcgtcggcacg
ctggagtccggttcggaccagatcgcctcggtcgccgacccgtacacggcgaacgccgtc
agcgaggacggttcgacggcgtacatctccgtctcctacaaggtgaactcgatggagctc
accgacgcgacacgggattcgctggagcacgcgggcgaggccgcccggagcgacgggctg
accgtggagatcggcggtgacgcgctccaggtgatgccggagaccggggtcaccgaggtc
atcggggtcgccatcgccgcggtggtgctggtcatcaccttcggttcgctgatcgccgcg
gggctgccgctgctgaccgcgctcatcggcgtcggcatcggggtgtcgctgatcacggcc
ctggcgaacgtgctggacctcggctccaccacctccacgctcgccatgatgatcggcctg
gcggtcggtatcgactacgccctgttcatcgtctcccgttaccgggccgagctggccgag
ggccgggaacgcgaggaggccgcggggcgggccgtcggcacggccgggtccgccgttgtc
ttcgccggcctgaccgtcgtcatcgcgctggtgggcctcgccgtcgtcaacatcccgatg
ctgtcgaagatgggcttcgccgccgccggtaccgtcgcgatcgcggtcctcatcgcgctc
accctggtgcccgccctgctcggggtcgccggcaagcaggtcatggggcgcaaggcgcgc
aaggccgccgacgcggagaacaagcccgacgccaagcccaacatgggcacccgctgggcg
cggttcgtgctgcgcaagccggtgtgggtcctgctggccggtgtcgtggggctcggcgtc
atagccgtcccggccgcctcgctggagatgggcctgccggacgacggctcgcagcccagg
agcaccacgcagcgccaggcctacgatctgctctccgacggcttcggcccggggttcaac
ggtccgctgctggtggtcgtggacaccaggaacagctcggacggcaagaccgcggtcgcg
caggtctcccagggcatcgaggcgagcggccacgtcgccgccgtcaccccggccaccttc
aacaaggccggcgacgccgcgaccatcaccgtcatcccgaaggaccggccgagctccacc
gacacggagaacgtcgtccacgccatccgcgacgcgggtgcggacatcaagagcgagacc
ggtgccgaggtgctggtcaccggcgccaccgcgatgaacatcgacttctccgagaagatg
aacgacgcgctgctgccctatctggcgctcgtcgtcggactcgccttcctgctgctgatg
gtcgtcttccgctcattgctggtgccgctcaaggcggccctcggcttcctgctctcggtc
gtcgcggccctgggcgcggtcgtcgcggtcttccagtggggctggctcgcctcgctcttc
ggggtcgagcagaccggaccgatcatgagcatgatgccgatcttcatggtcggtgtggtc
ttcggcctcgcgatggactacgaggtcttcctggtcacccggatgcgtgaggcgtacgtc
cacggggagacgcccggccaggcgatcgtcaccggcttccggcacggggcccgggtggtc
acggccgccgcggtgatcatgatggccgtcttcgccggcttcatcggctccagcgagtcg
atgatcaagatgatcggcttctcgctggccatcgccgtcttcttcgacgccttcgtggtg
cgcatggccatcgtgcccgcggtgctggccctgctgggcaggcgcgcctggtggctgccg
cgctggctggaccgcgcgctgcccagcgtggacgtggagggcgaggggctccgcacggag
ccggcggccgacggtcccggtgagggcccgggcggggagcgagagctgagccgggtctga

DBGET integrated database retrieval system