KEGG   Streptomyces sp. SirexAA-E: SACTE_2638Help
Entry
SACTE_2638        CDS       T01601                                 

Definition
(GenBank) conserved hypothetical protein
Organism
ssx  Streptomyces sp. SirexAA-E
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: AEN10524
UniProt: G2NHT8
Position
complement(2977305..2978459)
Genome map
AA seq 384 aa AA seqDB search
MPPCKPLYGVSVSSSGLIYAVIVGAWAAYLVPMWLRRQDELNEARPTERFSTAIRLLSGR
AAMERRYAKELQGREAGEAPGDVDPDAVTDRIESVDVRAFSAPPAHTEARLHDPAHDAPD
PAADGRPREEVRPARRPRTPGGETERERRARRSQVLARRRRTTTVLFLAFTLGTVVAAVG
GLRFLWAPAVPAVMLSAYIVHLRGQERRRFVFTMDRRRAEVAAQRLRENRPRRHQPASAV
AAEPDEEPEAGHPIPAPTVSPQEAGRRALVEQTDHAEWVDQQRERGPAQGDSWEPVPVPL
PTYVTAPVAPRATGGVEVGDPETWSAARSSTAEPSQTGTSHPVVPDADPAPRRRGNQSKR
GRDRGRTPLFDQYDDEDRPRAANE
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atgccgccgtgcaaacccctctacggtgtgagcgtgagcagcagcggcctcatctacgca
gtcatcgtcggtgcctgggccgcctacctggtgccgatgtggctccgcaggcaggacgag
ctcaatgaagcccgtccgacggaacgcttcagcaccgccatccggctgctgtccggacgg
gcggccatggagcgccggtacgccaaggagctgcaggggcgagaagccggggaggcgcct
ggtgacgtggacccggatgccgtcacggaccgaatcgagtccgtcgacgtccgggccttt
tccgcgcccccggcacacacggaagcccggttgcacgatccggcgcacgacgcgccggat
cctgcggctgacgggcgcccgcgcgaggaggtgcggcccgccaggcgcccgcgcacgcct
ggcggggagacggagcgtgagcggcgggccagacgctcgcaggtcctcgcgcgccgtcgg
cgtacgaccaccgtcctgttcctggcgttcacgctgggcacggtcgtggcggcggtcggc
ggactccgcttcctctgggcacccgccgtccccgcggtgatgctcagcgcgtacatcgtc
catctgcgcgggcaggaacgccgccggttcgtcttcaccatggaccggcgcagggcggag
gtggccgcccagcggctccgcgagaaccgcccgcgcaggcaccagccggcctcggcggtc
gccgccgagcccgacgaggagcccgaagcgggccacccgatccccgccccgacggtctct
ccgcaggaagccggccgccgtgcgctcgtcgagcagacggaccacgccgagtgggtggac
cagcagcgcgaacgcggcccggcccagggcgacagctgggagcccgtgcccgtaccgctg
ccgacctacgtcaccgccccggtcgccccgcgcgccacgggcggggtggaggtcggcgac
ccggagacctggagcgcggcccgctccagcacggcggaaccctcccagacgggcacctcg
caccccgtcgtccccgacgcggacccggcgccccgtcggcgcggcaaccagtccaagcgc
ggccgtgaccgcggccgtactcccctcttcgaccagtacgacgacgaggaccggccccgc
gcggccaacgagtga

DBGET integrated database retrieval system