KEGG   Streptomyces sp. SirexAA-E: SACTE_2643Help
Entry
SACTE_2643        CDS       T01601                                 

Definition
(GenBank) UTP-glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
ssx  Streptomyces sp. SirexAA-E
Pathway
ssx00040  Pentose and glucuronate interconversions
ssx00052  Galactose metabolism
ssx00500  Starch and sucrose metabolism
ssx00520  Amino sugar and nucleotide sugar metabolism
ssx01100  Metabolic pathways
ssx01130  Biosynthesis of antibiotics
Module
ssx_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:ssx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    SACTE_2643
   00052 Galactose metabolism
    SACTE_2643
   00500 Starch and sucrose metabolism
    SACTE_2643
   00520 Amino sugar and nucleotide sugar metabolism
    SACTE_2643
Enzymes [BR:ssx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     SACTE_2643
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 Glycos_transf_2 IspD
Motif
Other DBs
NCBI-ProteinID: AEN10529
UniProt: G2NHU3
Position
complement(2981712..2982614)
Genome map
AA seq 300 aa AA seqDB search
MTQSRPRISKAVIPAAGLGTRFLPATKATPKEMLPVVDKPAIQYVVEEAVAAGLSDVLMI
TGRNKRPLEDHFDRNYELESALDRKGDAERLSKVQESSDLATMHYVRQGDPRGLGHAVLC
AAPHVGDQPFAVLLGDDLMDPRDPLLARMIEVQEREGGSVVALMEVDPAQIHMYGCAATE
ATADSDVVRVTGLVEKPDPADAPSNLAVIGRYVLDPAVFGILRRTEPGRGGEIQLTDALQ
LLAEDEKIGGPVHGVVFKGRRYDTGDRGDYLRAIVRLACEREDLGPDFRTWLKRYVTEEL
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
atgactcagtcgcgccccaggatcagcaaagctgtcatcccagctgcaggtctcggcacc
cggttcctgccggccaccaaggccactccgaaagagatgctgcctgtcgtcgacaagccc
gccatccagtatgtcgtcgaggaggctgtcgccgcaggcctctccgacgtgctgatgatc
actggtcgcaacaagcgtcccctggaggaccacttcgaccggaactacgagctggagtcg
gcgctggaccgcaagggggacgccgaacggctctccaaggtccaggagtccagcgacctg
gccaccatgcactacgtccgccagggtgacccgcgtggcctcggccacgccgtcctgtgc
gccgccccgcacgtgggcgaccagcccttcgccgtcctcctcggcgacgacctgatggac
ccccgggacccgctgctcgcccggatgatcgaggtccaggagcgggagggcggcagcgtg
gtcgccctcatggaggtcgacccggcccagatccacatgtacggatgcgcggccaccgag
gccaccgcggacagtgacgtcgtgcgggtcacagggctggtggagaagcccgacccggcc
gacgcccccagcaatctcgccgtcatcggccgctacgtcctggaccccgcggtcttcggc
atactgcgccggaccgagcccggccgcggtggcgagatccagctcaccgacgccctccag
ctgctggccgaggacgagaagatcggcggcccggtgcacggcgtcgtcttcaagggccgc
cgttacgacaccggggaccgcggcgactacctgcgtgccattgtcagactggcgtgcgaa
cgtgaggacctgggcccggacttccggacctggctgaagcggtacgtcaccgaggagttg
tag

DBGET integrated database retrieval system