KEGG   Streptomyces sp. SirexAA-E: SACTE_2645Help
Entry
SACTE_2645        CDS       T01601                                 

Definition
(GenBank) peptidase S45 penicillin amidase
  KO
K01434  penicillin amidase [EC:3.5.1.11]
Organism
ssx  Streptomyces sp. SirexAA-E
Pathway
ssx00311  Penicillin and cephalosporin biosynthesis
ssx01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:ssx00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00311 Penicillin and cephalosporin biosynthesis
    SACTE_2645
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:ssx01002]
    SACTE_2645
Enzymes [BR:ssx01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.11  penicillin amidase
     SACTE_2645
Peptidases [BR:ssx01002]
 Cysteine Peptidases
  Family C59
   SACTE_2645
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Penicil_amidase
Motif
Other DBs
NCBI-ProteinID: AEN10531
UniProt: G2NHU5
Position
complement(2983386..2986130)
Genome map
AA seq 914 aa AA seqDB search
MPANTTAPSGSSDAKKPGRKKGRRARLLVIVLVLALVAGVGYGAYWSVSTVRASYPQTTG
TLELKGLTGDVDVKRDDYGIPQIYADSDADLFRAQGFVQAQDRFWEMDVRRHMTSGRLSE
MFGSDQVDTDAFLRTLGWRKVAQEEYDKVLDEDTKKNLQAYAEGVNAYLAGKDGKDISVE
YAALGLTNDYKPTEWTPVDSVAWLKAMAWDLRGNMQDEIDRSLLTSRLSEKQIEDLYPEY
PYKKNRPIVDQGAVSPVTGEFDPEAEPSDDIGGDTVAGATDGLNTQLSALSDTLDEIPAL
LGPNGNGIGSNSWVVSGAHTTTGKPLLANDPHLAPMLPSLWYQMGLHCREVSKTCRYDTA
GYTFSGMPGVIIGHNQDIAWGFTNLGADVTDLFLEKVSADGYQYDGKTEPFVTREETIKV
AGGKSRKITVRETNNGPLVSDRSSEMEKVGKRAPVTNSAPDRGDGYAIALKWTALDPGKS
MDAVFELNRAKDFKTFRAAAEHFEVPSQNLIYADTEGNIGYQAPGKIPVRLNGDGTMPSP
GWSSKYGWEKDPIPFDELPYEYNPERGYIVTANQAVIDDSYKHMLTKDWGYGARSQRIND
LIQKKIDDGGKVSTDDMQSMQMDNQSAIAAKLVPKLVKIGISDKSVREAQKLLEGWDYTQ
ESDSAAAAYFNGVWRNILKLAFGNKLPKELRPKGECLNVRPAAGTGPVDEQNKLVRECGQ
RDPDTAQPDGGDRWYEVVESILDDTDNEWWKVPAQGREEAIDNRDQLFARAMEDARWELT
AKLGKDISTWNWGRLHQLTLRNQTLGTEGPDLLQRALNRGPWNLGGGEAAVNATGWNAAG
GYGVIWVPSMRMVVNVGDWDKSRWINLTGASGHAFSAHYTDQTDKWADGELLDWSYGKGA
VDKSTVDTLTLKKP
NT seq 2745 nt NT seq  +upstreamnt  +downstreamnt
atgcccgccaacacaaccgccccttccggctcttcggatgcgaagaagcccggcaggaag
aaggggcgacgcgctcgcctcctcgtgatcgtcctggtgctggcgctcgtcgcgggtgtc
gggtacggcgcgtactggtccgtctccacggtccgggcctcttatccgcagaccaccggc
acactcgaactcaagggcctcaccggtgacgtcgacgtcaagcgcgacgactacgggatc
ccgcagatctacgcggactccgacgccgacctgttccgcgcccagggcttcgtccaggcc
caggaccggttctgggagatggacgtccgacgccacatgacgtccggacggctctccgag
atgttcggctcggaccaggtcgacaccgacgccttcctgcgcaccctgggctggcgcaag
gtcgcccaggaggagtacgacaaggtcctggacgaggacaccaagaagaacctccaggcg
tacgcggagggcgtcaacgcgtatctggccggcaaggacggcaaggacatctccgtcgag
tacgcggccctcggcctcaccaacgactacaagcccaccgagtggaccccggtcgactcg
gtcgcctggctgaaggcgatggcctgggacctgcgcggcaacatgcaggacgagatcgac
cgctccctgctgaccagccggctcagcgagaagcagatcgaggacctgtacccggagtac
ccgtacaagaagaacaggccgatcgtcgaccagggcgccgtctcgccggtcaccggtgag
ttcgaccccgaggccgaaccgtcggacgacatcggcggggacaccgtggcgggcgcgacc
gacgggctgaacacccagctctccgcgctctccgacaccctggacgagatccccgcactg
ctgggcccgaacggcaacggcatcgggtccaactcgtgggtggtctccggcgcccacacg
accaccggcaagccgctgctggccaacgacccgcacctggcgccgatgctgccctcgctc
tggtaccagatggggctgcactgccgtgaggtctccaagacctgccggtacgacacggcc
gggtacaccttctccggtatgcccggggtgatcatcgggcacaaccaggacatcgcctgg
ggcttcaccaacctcggcgccgacgtcacggacctgttcctggagaaggtctcggccgac
ggctaccagtacgacggcaagaccgagcccttcgtcacccgtgaggagaccatcaaggtc
gcgggcggcaagagccggaagatcaccgtccgggagaccaacaacggtcccctggtctcc
gaccgcagcagcgagatggagaaggtcggcaagcgggcgccggtcaccaactcggccccc
gaccgcggcgacggctacgccatcgccctgaagtggaccgcgctggaccccggcaagtcc
atggacgccgtcttcgagctcaaccgcgccaaggacttcaagaccttccgggcggcggcc
gagcacttcgaggtgccctcgcagaacctcatctacgcggacaccgagggcaacatcggc
taccaggccccgggcaagatcccggtccgcctgaacggcgacggcaccatgccgagcccg
ggatggtcctcgaagtacggctgggagaaggacccgatccccttcgacgagctgccgtac
gagtacaacccggagcgcggttacatcgtcaccgccaaccaggcggtcatcgacgacagc
tacaagcacatgctcaccaaggactggggctacggagcccgcagccagcggatcaacgac
ctgatccagaagaagatcgacgacggcggcaaggtctccaccgacgacatgcagtcgatg
cagatggacaaccagagcgccatcgccgcgaagctggtgccgaagctggtgaagatcggg
atctccgacaagagcgtccgtgaggcccagaagctgctggagggctgggactacacccag
gagtccgactccgccgcggccgcctacttcaacggtgtctggcgcaacatcctcaaactg
gccttcggcaacaagctccccaaggagctccgccccaagggcgagtgcctcaacgtgcgg
cccgccgccggcaccggaccggtcgacgagcagaacaagctcgtacgcgagtgcggccag
cgcgacccggacacggcgcagccggacgggggcgaccgctggtacgaggtcgtggagtcg
atcctcgacgacacggacaacgagtggtggaaggtgcccgcccagggccgtgaagaggcg
atcgacaaccgggaccagctcttcgcccgtgccatggaggacgcccgctgggagctgacc
gccaagctcggcaaggacatcagcacctggaactggggccggctgcaccagctgaccctg
cgcaaccagacgctcggcaccgagggcccggacctgctccagcgggcgctcaaccgcggc
ccctggaacctgggcggcggcgaggccgcggtcaacgccacgggctggaacgccgcgggc
ggctacggcgtcatctgggtgccgtccatgcggatggtcgtcaacgtgggggactgggac
aagtcccgctggatcaacctcaccggcgcttccggacacgcgttcagcgcgcactacacc
gaccagaccgacaagtgggccgacggcgaactgctcgactggtcctacgggaagggcgcc
gtggacaagtccacggtcgacaccctgacgctcaagaaaccgtga

DBGET integrated database retrieval system