KEGG   Streptomyces sp. SirexAA-E: SACTE_2650Help
Entry
SACTE_2650        CDS       T01601                                 

Definition
(GenBank) conserved hypothetical protein
Organism
ssx  Streptomyces sp. SirexAA-E
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RcpC
Motif
Other DBs
NCBI-ProteinID: AEN10535
UniProt: G2NHU9
Position
2991217..2991828
Genome map
AA seq 203 aa AA seqDB search
MFPSMPDTRPAPPAPCGMPSFEPLRVRGGGRLRRALRRQRRAVAAGFALSSAVLAVSGLG
GSGLGAGGAGPPTDGGAAVAGDARPVSRQEQSPGPLVSAPVRIADAGAVSLLQPGDRVDV
LAARDGAAKARVVARDVRVTHVPVGRPDGTDGPLPGPGFAEPDGGPGAGGGALVVLAVER
ETAAVLAGAGASGPLAVAVSRGH
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
atgttcccgtccatgcccgacacacgtcccgcgcctcccgcaccgtgcgggatgccctcc
ttcgagccgctgcgggtgcgcggcggcggccggctgcggcgcgcgctgcggagacagagg
cgcgcggtggcggcgggattcgccctgtcctccgccgtgctcgccgtgtccgggctcggg
ggttccggactcggcgcgggtggtgccggcccgccgacggacggcggagccgccgtcgcg
ggtgacgcccgtccggtgtcccggcaggagcagtcgcccggcccgctggtctccgcaccg
gtgcggatcgcggacgcgggggcggtctcactgttacagccgggcgaccgcgtcgatgtg
ctggccgcgcgggacggggccgcgaaggcccgcgtggtggcgcgggacgtgcgggtgacg
cacgtgccggtcggccggccggacggcacggacggcccactgccgggcccgggcttcgcg
gagccggacggcggaccgggcgccgggggcggggctctggtggtcctcgccgtggagcgg
gagaccgcggccgttctggcgggcgcgggcgcgtcggggccgctcgccgtggcggtgtcc
cgtgggcactga

DBGET integrated database retrieval system