KEGG   Streptomyces sp. SirexAA-E: SACTE_2653Help
Entry
SACTE_2653        CDS       T01601                                 

Definition
(GenBank) Rieske (2Fe-2S) iron-sulfur domain protein
Organism
ssx  Streptomyces sp. SirexAA-E
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Rieske UCR_Fe-S_N
Motif
Other DBs
NCBI-ProteinID: AEN10538
UniProt: G2NHV2
Position
complement(2992523..2993218)
Genome map
AA seq 231 aa AA seqDB search
MSVTEQQQPGGGGNPDGDPREALHDRIAADSLTTRRDYLRIVTTVSGGLAVGGLGVAAGI
LQRHGEEPDGKAPAPKRIAAQLLPGESLAFRYPGDEDRAVAVRMDDGTLVGYSAVCTHLA
CAVLWRKDRGTEGELYCPCHEGVFDARTGEVTAGPPPRGLPKVALTELDDGSIWAVGTTR
SGESIEAGLCRQLGDDRPDLAARIGCPGTGGGAEAPSAPDPSAATTPGRRA
NT seq 696 nt NT seq  +upstreamnt  +downstreamnt
atgagcgtcaccgaacagcagcagccgggcggcggcggcaaccccgacggcgacccccgc
gaagctctgcacgaccggatcgccgccgactcgctgaccacccgacgtgactacctccgc
atcgtcaccacggtctccggcggcctcgcggtgggtggcctgggcgtcgccgccgggatt
ctccagcggcacggcgaagagccggacggcaaggcaccggccccgaaacggatcgccgcg
cagctcctgcccggcgaatccctcgccttccgctaccccggtgacgaggaccgcgccgtc
gccgtacgcatggacgacggcaccctcgtcggctactccgccgtgtgcacccacctcgcc
tgcgccgtgctctggcgcaaggaccgcggcacggagggagagctctactgcccatgtcac
gaaggggtgttcgacgcccgcaccggagaggtcacggcgggccccccaccgcgcggcctg
cccaaggtggcgctgaccgagctcgacgacggcagcatctgggccgtcggcaccacacgc
tccggcgaaagcatcgaggcggggctctgccgacagctcggcgacgatcgcccggacctc
gccgcccggatcggctgccccggcaccggaggcggcgcggaggccccgtcggccccggac
ccgtccgcggccacgacgcccgggaggcgggcatga

DBGET integrated database retrieval system