KEGG   Streptomyces sp. SirexAA-E: SACTE_2681Help
Entry
SACTE_2681        CDS       T01601                                 

Definition
(GenBank) alkylhydroperoxidase like protein, AhpD family
Organism
ssx  Streptomyces sp. SirexAA-E
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CMD
Motif
Other DBs
NCBI-ProteinID: AEN10566
UniProt: G2NHY0
Position
complement(3027363..3027836)
Genome map
AA seq 157 aa AA seqDB search
MEARLNVFGSPLAAKVIKHINAAGKVISDSPLPAATQELVKIRASQINGCGFCLDMHTKE
AVEAGETSTRLHLVAGWREATVFTDAERAALELAEEGTRIADGAGGVTDEVWANAAKHYD
EEQLTALVAIIALINTYNRFNVITRQPAGDYRPGQFA
NT seq 474 nt NT seq  +upstreamnt  +downstreamnt
atggaagcccgtctcaacgtcttcggcagcccgctcgcagccaaggtcatcaagcacatc
aacgcggccggcaaggtgatctcggactcgccgctgcccgccgccacccaggaactggtc
aagatccgtgccagccagatcaacggctgcgggttctgcctcgacatgcacaccaaggag
gccgtcgaggcaggtgagacctcgacgcgtctgcacctggtcgcgggctggcgggaggcg
acggtgttcaccgacgccgagcgcgccgccctggagctggccgaagagggcacccgtatc
gccgacggcgcgggcggggtcacggacgaggtctgggcgaacgccgccaagcactacgac
gaggagcagctcaccgccctggtggccatcatcgccctcatcaacacctacaaccgcttc
aacgtcatcacccggcagcccgcgggcgactaccggcccggccagttcgcctga

DBGET integrated database retrieval system