KEGG   Streptomyces sp. SirexAA-E: SACTE_2683Help
Entry
SACTE_2683        CDS       T01601                                 

Definition
(GenBank) transcriptional regulator, XRE family
Organism
ssx  Streptomyces sp. SirexAA-E
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HTH_31 HTH_3 HTH_19 HTH_25 HTH_AraC
Motif
Other DBs
NCBI-ProteinID: AEN10568
UniProt: G2NHY2
Position
3028344..3029171
Genome map
AA seq 275 aa AA seqDB search
MTEQPADVDEESGRAALGRALRYLREQSGKSLGQLAEETRYDKSYLYRLETGQRLSKLAV
MEDLDRYYKSGDLLVRLWKVARREVFKDRYKEFMRLEATACIMHLFTLGIPGLLQTEDVA
RVSLSGAQETAAEAELVEDQVVARMGRQQLLHRTPAPSVRIIIDEYALRRPVMDGKMWHE
QLTHLIDMAELPSIVLQVLPFSVGAHHLMDGSLTLLWQEDGTPSAYTEGNGCAELFEDPA
SVTRCRLSYDRLRDRALPPPGSIGFIRGVLEEHSS
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
gtgacggaacaaccggccgacgtggacgaggagtcgggtcgcgcggccctggggcgggcc
ctgcggtacctcagggaacagtcgggcaagtccctcggccagctggcggaggagacccgg
tacgacaagagctacctgtaccggctggagaccggccagcggctgtccaagctggccgtg
atggaggacctggaccgctattacaagtccggggacctgctggtgcggctgtggaaggtg
gcccgccgggaggtcttcaaggaccggtacaaggagttcatgcggctggaggcaacagcc
tgcatcatgcacctcttcacgctcgggattccagggcttctccagacggaggacgtcgcc
cgggtgtcgttgtccggcgctcaggaaacggcggcggaggccgagttggtggaggaccag
gtggtggcacggatgggccgccagcaattgcttcaccgcaccccagcgccttcggtacgg
atcatcatcgacgagtacgccctgcgtcgccccgtcatggacgggaagatgtggcacgag
cagctgacgcatctgatcgacatggcggagctgccgtcgatcgtccttcaggtactgccg
ttctcggtgggcgcccaccacctcatggacggctcgctgaccctgctctggcaggaggac
gggacccccagtgcctacacggaaggcaatggctgcgccgagctgttcgaagatccggcg
tccgtgacacgttgtcggctgtcctacgatcgcctccgggaccgggcgttgcccccgccg
gggtccatcgggttcatcaggggtgtcctggaggagcacagttcatga

DBGET integrated database retrieval system