KEGG   Streptomyces sp. SirexAA-E: SACTE_2706Help
Entry
SACTE_2706        CDS       T01601                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
ssx  Streptomyces sp. SirexAA-E
Pathway
ssx00071  Fatty acid degradation
ssx00072  Synthesis and degradation of ketone bodies
ssx00280  Valine, leucine and isoleucine degradation
ssx00310  Lysine degradation
ssx00362  Benzoate degradation
ssx00380  Tryptophan metabolism
ssx00620  Pyruvate metabolism
ssx00630  Glyoxylate and dicarboxylate metabolism
ssx00640  Propanoate metabolism
ssx00650  Butanoate metabolism
ssx00900  Terpenoid backbone biosynthesis
ssx01100  Metabolic pathways
ssx01110  Biosynthesis of secondary metabolites
ssx01120  Microbial metabolism in diverse environments
ssx01130  Biosynthesis of antibiotics
ssx01200  Carbon metabolism
ssx01212  Fatty acid metabolism
ssx02020  Two-component system
Brite
KEGG Orthology (KO) [BR:ssx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    SACTE_2706
   00630 Glyoxylate and dicarboxylate metabolism
    SACTE_2706
   00640 Propanoate metabolism
    SACTE_2706
   00650 Butanoate metabolism
    SACTE_2706
  09103 Lipid metabolism
   00071 Fatty acid degradation
    SACTE_2706
   00072 Synthesis and degradation of ketone bodies
    SACTE_2706
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SACTE_2706
   00310 Lysine degradation
    SACTE_2706
   00380 Tryptophan metabolism
    SACTE_2706
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    SACTE_2706
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    SACTE_2706
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    SACTE_2706
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ssx04147]
    SACTE_2706
Enzymes [BR:ssx01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     SACTE_2706
Exosome [BR:ssx04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SACTE_2706
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: AEN10589
UniProt: G2NL07
Position
complement(3053262..3054539)
Genome map
AA seq 425 aa AA seqDB search
MVALIPLPLPQPRRVAVIGGSRIPFARSDGPYAEASNQQMLTAALDGLAERFGLRGESVG
EFVAGAVLKHSRDFNLARETVLGSVLDPRTPAYDVQQACGTGLQAVIAAANKIALGAVDS
AVAGGADTTSDAPLGVNDQLRRILLRARRATSAGGRLKALAAVRPRHLVPDIPRNAEPRT
GRSMGEHAAVTALKWGIAREEQDLLAATSHQRLAAAYERGFLDDLVVPYLGLERDQNLRP
GSTVEKLAGLDPVFGAGHPDATMTAGNSTPLTDGAATVLLASEGWAEARGHRPLAYLSLY
ETAAVDYVDGEDGLLMAPAYAVPRMLERAGLGIEDFDLVEIHEAFASQVLATLASWEKQG
LAPVDRHKLNVAGSSLATGHPFAATGARIVATLAKLLAERDAPGRGLISVCAAGGQGVTA
ILERP
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
ttggtcgcgttgattcccctgccactgccgcagccgcgccgggtcgccgtcatcggcggc
agccggatcccgttcgcccgctccgacggcccctacgccgaggcctccaaccagcagatg
ctgaccgccgcgctggacggactggccgaacgcttcggtctgcgcggggagtcggtgggc
gagttcgtcgcgggcgcggtcctcaagcacagccgcgacttcaatctggcccgcgagacg
gtcctgggctcggtcctcgacccgcgcaccccggcgtacgacgtccagcaggcctgcggc
accgggctccaggccgtgatcgcggccgcgaacaagatcgcgctcggcgccgtcgactcg
gcggtcgcgggcggcgcggacaccaccagcgacgccccgctcggcgtcaacgaccagctg
cgcaggatcctgctccgggcgcggcgggcgacgtcggcgggcggcaggctcaaggcgctc
gcggccgtacgcccccgccacctcgtgccggacatcccgcgcaacgccgaaccccgcacc
ggtcggtcgatgggcgagcacgccgccgtcaccgccctgaagtggggcatcgcccgcgag
gagcaggacctgctcgcggccaccagccaccagcggctcgccgccgcgtacgaacgcggc
ttcctggacgacctggtggtcccctacctcggtctggaacgcgaccagaacctccgtccc
ggctccaccgtcgagaaactggccggcctcgatccggtgttcggcgccggccaccccgac
gcgacgatgaccgcggggaactcgaccccgctcaccgacggagccgccaccgtgctgctg
gcgagcgaggggtgggccgaggcccgcggccaccggccgctcgcctacctgtcgttgtac
gagacggccgcggtggactacgtggacggcgaggacgggctgctgatggcgcccgcgtac
gccgtaccgcggatgctggagcgggccgggctcggcatcgaggacttcgacctcgtcgag
atccacgaggcgttcgcctcccaggtgctggccaccctggcctcctgggagaagcagggc
ctggcccccgtggaccgccacaaactcaacgtggccgggtcgtccctcgccaccgggcac
ccgttcgccgcgaccggggcccggatcgtcgccaccctcgccaagctcctcgcggagcgg
gacgccccgggccgtggcctgatctccgtctgcgcggcgggcggccagggggtcacggcg
atcctcgaacgcccctga

DBGET integrated database retrieval system