KEGG   Streptomyces sp. SirexAA-E: SACTE_2708Help
Entry
SACTE_2708        CDS       T01601                                 

Definition
(GenBank) MaoC domain protein dehydratase
Organism
ssx  Streptomyces sp. SirexAA-E
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MaoC_dehydratas MaoC_dehydrat_N
Motif
Other DBs
NCBI-ProteinID: AEN10591
UniProt: G2NL09
Position
3055938..3056792
Genome map
AA seq 284 aa AA seqDB search
MAALGTTLLRGAVTSPFKRAGRPGASLPATREVRPAAPAAPGPLATYRSVCGFTGADSLP
LTYPHVLGFPLALRIMTGRAFPLPVLGLVHTWIEITRHRPLRPTDPLELRVRAVELTPHR
RGTEVTMATEARLAGETVWESRSGYLSRHPTDTSAATGPPAPPAPRELPAVAEWRLPSDL
GRRYGAASGDRNPIHLHPLTARLFGFPRHIAHGMWTVARCLAEAENGPASGPGRGGRDDI
LSVRADFKAPVLLPATVTYAAAGSDFQVRGESRVHLTGSVVRDG
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
atggccgccctcggcacgaccctcctgcgcggggccgtcacctcccccttcaagcgggcg
ggccgccccggagcgtccctgcccgccacccgcgaggtgcggcccgccgcgcccgccgca
ccgggccccctcgccacgtaccggtccgtctgcggcttcaccggcgcggacagcctgccg
ctcacctacccgcacgtcctgggtttcccgctcgccctgcggatcatgacgggccgggcc
ttcccgctgccggtcctcggtctggtgcacacctggatcgagatcacccgccaccggccg
ctgcggccgacggacccgctggaactccgggtgcgcgccgtcgaactgacgccccatcgg
cgcggcaccgaggtcacgatggccaccgaggcacgactcgcgggcgagacggtctgggag
tcacgcagcggctatctgtcccgccaccccaccgacacgtccgccgccaccgggccgccc
gcgccaccggccccgcgtgagctgccggcggtcgccgagtggcggctgcccagcgacctc
gggcgccgttacggcgccgcctcgggcgaccggaacccgatccacctgcacccgctcacc
gcccggctgttcggcttcccccggcacatcgcccacggcatgtggacggtcgcccgctgc
ctcgcggaggcggagaacggaccggcctcgggccccggaaggggcgggcgggacgacatc
ctctcggtacgggccgacttcaaggcccccgtcctgctgcccgccacggtcacctacgcg
gcggcgggatccgacttccaggtacggggcgagagccgcgtccacctcaccggcagcgtg
gtccgggacggctga

DBGET integrated database retrieval system