KEGG   Streptomyces sp. SirexAA-E: SACTE_3012Help
Entry
SACTE_3012        CDS       T01601                                 

Definition
(GenBank) acetate/CoA ligase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
ssx  Streptomyces sp. SirexAA-E
Pathway
ssx00010  Glycolysis / Gluconeogenesis
ssx00620  Pyruvate metabolism
ssx00640  Propanoate metabolism
ssx00680  Methane metabolism
ssx01100  Metabolic pathways
ssx01110  Biosynthesis of secondary metabolites
ssx01120  Microbial metabolism in diverse environments
ssx01130  Biosynthesis of antibiotics
ssx01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ssx00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SACTE_3012
   00620 Pyruvate metabolism
    SACTE_3012
   00640 Propanoate metabolism
    SACTE_3012
  Energy metabolism
   00680 Methane metabolism
    SACTE_3012
Enzymes [BR:ssx01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     SACTE_3012
Lipid biosynthesis proteins [BR:ssx01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   SACTE_3012
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N BAT
Motif
Other DBs
NCBI-ProteinID: AEN10880
UniProt: G2NL74
Position
3366092..3368059
Genome map
AA seq 655 aa AA seqDB search
MGDVVSNESLANLLKEERRFAPPADLAANANVTVEAYEQAEADRLGFWAEQARRLTWATE
PTETLDWSNPPFAKWFADGELNVAYNCVDRHVEAGNGARVAIHFEGEPGDSRAITYAELK
DEVSRAANALTELGVGKGDRVAVYLPMIPEAAIAMLACARIGAAHSVVFGGFSADAIAAR
IQDADAKVVITADGGYRRGKPSALKPAVDDAVSRLDTVDHVVVVRRTGQDTAWTEGRDVW
WHEITGRQSAEHTPEAFDAEQPLFILYTSGTTGKPKGILHTSGGYLTQAAYTHHAVFDLK
PETDVYWCTADIGWVTGHSYIVYGPLANGATQVMYEGTPDTPHQGRFWEIVQKYGVSILY
TAPTAIRTFMKWGDDIPAKFDLSSLRVLGSVGEPINPEAWMWYRKHIGADTCPIVDTWWQ
TETGAMMISPLPGVTATKPGSAQRALPGISATVVDDEAREVPDGGGGYLVLTEPWPSMLR
TIWGDDQRFIDTYWSRFEGKYFAGDGAKKDEDGDIWLLGRVDDVMLVSGHNISTTEVESA
LVSHPSVAEAAVVGANDETTGQAIVAFVILRGTATASEELVTELRNHVGTTLGPIAKPKR
VLPVAELPKTRSGKIMRRLLRDVAENRELGDVTTLTDSSVMDLIQTQLPAASSED
NT seq 1968 nt NT seq  +upstreamnt  +downstreamnt
atgggagatgtcgtgagcaacgaaagcctggccaatctgctcaaggaggagcggcggttc
gcaccgcctgccgatctggccgcgaacgccaacgtgaccgtggaggcgtacgagcaggcc
gaggcggaccggctgggcttctgggccgagcaggcccgtcgcctgacgtgggccacggag
ccgaccgagacgctcgactggagcaacccgcccttcgcgaagtggttcgcggacggcgag
ctcaacgtcgcgtacaactgcgtggaccgtcacgtcgaggcgggtaacggcgcccgggtc
gccatccacttcgagggtgagcccggggacagccgcgccatcacctacgccgagctcaag
gacgaggtctcccgggcagccaacgccctgaccgaactgggtgtcggcaagggcgaccgg
gtcgccgtctacctgccgatgattcccgaggcggccatcgccatgctggcctgtgcccgt
atcggcgccgcgcactcggtggtcttcggcggcttctccgccgacgccatcgccgcccgc
atccaggacgcggacgccaaggtcgtcatcaccgccgacggcggttaccgccggggcaag
ccgtccgccctcaagccggccgtggacgacgccgtctccaggctcgacaccgtcgatcac
gtcgtcgtcgtccggcgcaccggacaggacacggcgtggacggagggccgcgacgtctgg
tggcacgagatcaccggccggcagtccgccgagcacacccccgaggccttcgacgcggag
cagccgctcttcatcctctacacctcgggcaccaccggaaagccgaagggcatccttcac
acctccggcgggtacctcacccaggcggcctacacgcaccacgcggtcttcgacctcaag
cccgagaccgacgtctactggtgcaccgccgacatcggctgggtgaccgggcactcgtac
atcgtgtacgggccgctggccaacggcgccacccaggtgatgtacgagggcacccccgac
accccccaccaggggcgtttctgggagatcgtccagaagtacggcgtctcgatcctctac
acggctccgacggcgatccggacgttcatgaagtggggagacgacatccccgccaagttc
gacctgtcgtcgctgcgcgtcctcggttcggtcggcgagccgatcaaccccgaggcgtgg
atgtggtaccgcaaacacatcggcgccgacacctgcccgatcgtcgacacctggtggcag
accgagaccggcgcgatgatgatctcgccgcttcccggggtcacggcgaccaagcccggt
tcggcgcagcgcgccctgcccggcatctccgccacggtcgtggacgacgaagcacgcgag
gtgccggacggcggaggcggctatctggtcctcaccgagccgtggccgtcgatgctccgc
accatctggggcgacgaccagcggttcatcgacacctactggtcgcgcttcgagggcaag
tacttcgcgggtgacggcgccaagaaggacgaggacggcgacatctggctgctcggccgg
gtcgacgacgtcatgctcgtgtccgggcacaacatctcgaccaccgaggtcgagtccgcc
ctcgtctcgcacccgtcggtcgccgaggcggccgtggtcggcgccaacgacgagaccacc
ggtcaggccatcgtcgccttcgtgatcctgcgcggcacggccaccgcctccgaggaactg
gtcaccgaactacgcaaccacgtcggcaccacgctcggcccgatcgccaagcccaagcgg
gtgctgccggtcgccgagctgccgaagacccgttccgggaagatcatgcgtcgtctgctg
cgcgacgtcgcagagaaccgcgaactgggcgatgtcaccacgctcaccgactcgtcggtc
atggacctcatccagacgcagcttcccgccgcgtcttccgaggactag

DBGET integrated database retrieval system