KEGG   Streptomyces sp. SirexAA-E: SACTE_3578Help
Entry
SACTE_3578        CDS       T01601                                 

Definition
(GenBank) phosphate transporter
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
ssx  Streptomyces sp. SirexAA-E
Brite
KEGG Orthology (KO) [BR:ssx00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    SACTE_3578
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4 Myc_target_1
Motif
Other DBs
NCBI-ProteinID: AEN11432
UniProt: G2NCY6
Position
4001966..4002964
Genome map
AA seq 332 aa AA seqDB search
MDTFALIVTIGVALGFTYTNGFHDSANAIATSVSTRALTPRAALAMAAVMNLAGAFLGQG
VAKTVSEGLIATPEGQKGMGILFAALVGAIIWNLVTWYYGLPSSSSHALFGGMVGAALAG
GTMVHWDGVLSKIVIPMFLSPVIGLVVGYLVMVGIMWLFRNSNPHKAKRGFRIAQTVSAA
GMALGHGLQDAQKTMGIVVMALVIADVEGPNDQIPVWVKIVCAMMLSLGTYAGGWRIMRT
LGRKIIELDPPQGFAAETTGASIMFGSAFLFHAPISTTHVITSAIMGVGATKRVNAVRWG
VAKNIILGWFITMPAAALVAALSYGVVVLLFG
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
gtggacacctttgcgctgatcgtgaccatcggtgtcgcgctcggcttcacgtatacgaac
ggcttccacgactcggcgaacgccatcgccacctcggtctccacccgggcgctgaccccg
cgtgcggctctggcgatggccgcggtgatgaacctcgcgggcgccttcctgggccagggg
gtcgccaagaccgtcagcgaagggctcatcgccacgcccgagggccagaaggggatgggc
atcctcttcgcggcgctggtcggcgcgatcatctggaacctcgtcacctggtactacggt
ctgccgtcctcgtcctcgcacgcgttgttcggcggcatggtcggcgcggcgctggccggc
gggacgatggtgcactgggacggcgtgctctccaagatcgtcatcccgatgttcctctcc
ccggtcatcggcctggtcgtcggctatctggtgatggtcggcatcatgtggctgttccgg
aactccaacccgcacaaggccaagcgcggcttccgtatcgcgcagacggtctcggcggcg
ggcatggcgctgggccacggcctgcaggacgcccagaagacgatgggcatcgtggtgatg
gccctggtcatcgccgacgtcgaggggccgaacgaccagatcccggtctgggtgaagatc
gtctgcgcgatgatgctgtcgctcgggacgtacgccggcggttggcgcatcatgcgcacc
ctgggccgcaagatcatcgagctggacccgccgcaggggttcgcggcggagacgaccggc
gcctcgatcatgttcggctcggcgttcctgttccacgcgccgatctccacgactcatgtg
atcacctcggcgatcatgggcgtgggcgccacgaagcgggtgaacgcggtccgctggggc
gtggccaagaacatcatcctcgggtggttcatcacgatgccggccgcggcgctcgtcgcc
gcgctgagctacggggtcgtggtcctgctcttcggctga

DBGET integrated database retrieval system