KEGG   Streptomyces sp. SirexAA-E: SACTE_3822
Entry
SACTE_3822        CDS       T01601                                 

Definition
(GenBank) Enoyl-CoA hydratase/isomerase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
ssx  Streptomyces sp. SirexAA-E
Pathway
ssx00071  Fatty acid degradation
ssx00280  Valine, leucine and isoleucine degradation
ssx00281  Geraniol degradation
ssx00310  Lysine degradation
ssx00360  Phenylalanine metabolism
ssx00362  Benzoate degradation
ssx00380  Tryptophan metabolism
ssx00410  beta-Alanine metabolism
ssx00627  Aminobenzoate degradation
ssx00640  Propanoate metabolism
ssx00650  Butanoate metabolism
ssx00903  Limonene and pinene degradation
ssx00930  Caprolactam degradation
ssx01100  Metabolic pathways
ssx01110  Biosynthesis of secondary metabolites
ssx01120  Microbial metabolism in diverse environments
ssx01212  Fatty acid metabolism
Module
ssx_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:ssx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    SACTE_3822
   00650 Butanoate metabolism
    SACTE_3822
  09103 Lipid metabolism
   00071 Fatty acid degradation
    SACTE_3822
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SACTE_3822
   00310 Lysine degradation
    SACTE_3822
   00360 Phenylalanine metabolism
    SACTE_3822
   00380 Tryptophan metabolism
    SACTE_3822
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    SACTE_3822
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    SACTE_3822
   00281 Geraniol degradation
    SACTE_3822
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    SACTE_3822
   00627 Aminobenzoate degradation
    SACTE_3822
   00930 Caprolactam degradation
    SACTE_3822
Enzymes [BR:ssx01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     SACTE_3822
SSDB
Motif
Pfam: ECH_1 ECH_2
Other DBs
NCBI-ProteinID: AEN11667
UniProt: G2NLR9
Position
4241586..4242323
AA seq 245 aa
MTLAPPAHERGVTTLTLDSPANRNALSARLVEELADALDACAADDAVRAVVLTHTGNTFC
AGADLTAPPDPHDLVALMRRVVALPKPVVARVTGHVRAGGLGLLAACDISAAGPDASFAL
TESRLGLAPAVISLPLLPRLDPRAAARYYLTGERFDATEAARIGLVSLATADDVDKALVP
VLDGLRRASPQGLAASKELVTATVLDDFDQHSEDLIARSAALFASDDAREGMTAFLERRD
PAWRL
NT seq 738 nt   +upstreamnt  +downstreamnt
atgaccctcgccccacccgcccacgagcggggcgtcaccaccctcaccctcgactcaccg
gccaaccgcaacgccctcagcgcccggctcgtcgaagaactcgccgacgccctcgacgcc
tgcgccgccgacgacgccgtacgggccgtcgtcctcacccacaccgggaacaccttctgc
gcgggcgccgacctcaccgcgccgcccgacccgcacgacctcgtcgccctcatgcggcgc
gtcgtcgccctgcccaagcccgtcgtcgcccgggtcaccgggcacgtccgggccggcggg
ctcggcctcctcgcggcctgcgacatctccgccgccggaccggacgcctccttcgccctg
accgaatcccgcctcggcctcgcccccgccgtcatctccctgcccctgctgccccgcctc
gacccgcgcgccgccgcccgctactacctcaccggtgaacgcttcgacgcgacggaggcc
gcccgcatcggactcgtctccctcgccacggccgacgacgtggacaaggcactcgtaccg
gtcctggacggactgcgccgggcctcgccccaggggctggccgcatcgaaggagctggtc
accgctactgtgctggacgacttcgaccagcactccgaagacctcatcgcccgctcggcg
gccctgttcgcctccgacgacgcacgcgaggggatgacggccttcctcgaacgacgggac
cccgcatggcggctgtga

KEGG   Streptomyces sp. SirexAA-E: SACTE_5896
Entry
SACTE_5896        CDS       T01601                                 

Definition
(GenBank) 3-hydroxyacyl-CoA dehydrogenase NAD-binding protein
  KO
K01782  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
ssx  Streptomyces sp. SirexAA-E
Pathway
ssx00071  Fatty acid degradation
ssx00280  Valine, leucine and isoleucine degradation
ssx00281  Geraniol degradation
ssx00310  Lysine degradation
ssx00362  Benzoate degradation
ssx00380  Tryptophan metabolism
ssx00410  beta-Alanine metabolism
ssx00640  Propanoate metabolism
ssx00650  Butanoate metabolism
ssx00903  Limonene and pinene degradation
ssx00930  Caprolactam degradation
ssx01100  Metabolic pathways
ssx01110  Biosynthesis of secondary metabolites
ssx01120  Microbial metabolism in diverse environments
ssx01200  Carbon metabolism
ssx01212  Fatty acid metabolism
Module
ssx_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:ssx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    SACTE_5896
   00650 Butanoate metabolism
    SACTE_5896
  09103 Lipid metabolism
   00071 Fatty acid degradation
    SACTE_5896
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SACTE_5896
   00310 Lysine degradation
    SACTE_5896
   00380 Tryptophan metabolism
    SACTE_5896
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    SACTE_5896
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    SACTE_5896
   00281 Geraniol degradation
    SACTE_5896
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    SACTE_5896
   00930 Caprolactam degradation
    SACTE_5896
Enzymes [BR:ssx01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     SACTE_5896
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     SACTE_5896
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     SACTE_5896
SSDB
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2 NAD_binding_2 DAO AlaDh_PNT_C F420_oxidored NAD_binding_8 NAD_Gly3P_dh_N UDPG_MGDP_dh_N Pyr_redox_2
Other DBs
NCBI-ProteinID: AEN13680
UniProt: G2NGD9
Position
6710130..6712301
AA seq 723 aa
MTESTTIRWEQDETGIVTLVLDDPGQSANTMNQAFKDSIAAVADRAEAEKDSIRGIIYTS
AKKTFFAGGDLKDMIKVGPEDAQAAFDTGTAIKNSLRRIETLGKPVVAAINGAALGGGYE
IALASHHRVALDAPGSRIGLPEVTLGLLPAGGGVTRTVRLMGITDALLKVLLQGTQYTPA
RALENGLVHEIAATREEMLAKARAFIDTHPESRQPWDVKGYRIPGGTPSHPKFAANLPAF
PANLRKQLAGAPMPAPRNIMAAAVEGSQVDFETALTIEARYFTELVTGQVAKNMIQAFFF
DLQAVNSGASRPGGVEERQVRKVAVLGAGMMGAGIAYSCARAGLDVVLKDVSTEAAEKGK
AYSEKLLAKALSRGRTTEAKRDELLARITPTGDPADLAGCDAVIEAVFEDTALKHKVFQE
IQDVVEPDALLCSNTSTLPITVLAEGVERPADFIGLHFFSPVDKMPLVEIIKGDKTGDEA
LARAFDLVRRIKKTPIVVNDSRGFFTSRVIGHFINEGVAMVGEGIEPASVEQAAAQAGYP
AKVLSLMDELTLTLPRKIRDETRRAIEEAGGTWPAHPADAVVDRMVDEFGRPGRSGGAGF
YEYGEDGRRGLLWPGLREHFTRPGAEIPFEDMQERMLFSEALDSVRCLEENVLTTVADAN
IGSIMGIGFPPWTGGVLQYINGYEGGLPGFVARARQLAERYGDRFLPSPLLLEKAEKGET
FHD
NT seq 2172 nt   +upstreamnt  +downstreamnt
atgaccgagagcacgaccatccgctgggaacaggacgagaccggcatcgtcaccctcgtc
ctggacgatcccggccagtccgccaacacgatgaaccaggcgttcaaggactcgatcgcc
gccgtcgccgaccgggccgaggccgagaaggactccatccggggcatcatctacacctcc
gccaagaagaccttcttcgcgggcggcgacctcaaggacatgatcaaggtcggccccgag
gacgcccaggccgccttcgacaccggtaccgcgatcaagaactcgctgcgccgcatcgag
acgctcggcaagccggtcgtcgccgcgatcaacggtgccgcgctcggcggcggttacgag
atcgccctcgcctcccaccaccgcgtcgccctggacgccccgggctcccgcatcggcctg
cccgaggtcaccctcggcctgctgcccgcgggcggcggcgtcacccgcaccgtacgcctc
atgggcatcaccgacgcgctgctcaaggtcctcctccagggcacccagtacacccccgcc
cgggcgctggagaacggcctggtccacgagatcgccgccacgcgcgaggagatgctcgcc
aaggcgcgcgccttcatcgacacccacccggaatcgcggcagccctgggacgtcaagggc
taccgcatccccggcggcaccccgtcccatccgaagttcgccgccaacctgcccgccttc
cccgccaacctgaggaagcagcttgcgggcgcgcccatgcccgcgccccgcaacatcatg
gccgcggcggtcgagggatcgcaggtcgacttcgagaccgctctgaccatcgaggcccgc
tacttcaccgaactggtcaccggccaggtcgcgaagaacatgatccaggccttcttcttc
gacctccaggccgtcaactccggggccagccgcccggggggagtggaggaacgccaggtc
cgcaaggtcgccgtcctcggcgccgggatgatgggtgcgggcatcgcctactcctgcgcc
cgcgccggcctcgacgtcgtcctcaaggacgtctccaccgaggcggccgagaagggcaag
gcctacagcgagaagctgctcgccaaggcgctctcccggggccgtacgaccgaggcgaag
cgcgacgaactgctcgcccgcatcacccctaccggcgacccggcggatctggccggctgc
gacgcggtgatcgaggccgtcttcgaggacaccgcgctcaagcacaaggtgttccaggag
atccaggacgtcgtcgagcccgacgcgctgctctgctccaacacctccaccctgcccatc
acggtcctcgccgagggcgtggagcggcccgccgacttcatcgggctgcacttcttctcg
ccggtcgacaagatgccgctggtggagatcatcaagggcgacaagaccggtgacgaggcg
ctggcccgcgccttcgacctggtgcgccggatcaagaagaccccgatcgtcgtcaacgac
tcccgcggcttcttcacctcgcgtgtcatcggccacttcatcaacgagggcgtcgccatg
gtcggcgagggcatcgagcccgcgtccgtcgagcaggcggcggcgcaggccggctacccg
gccaaggtcctcagcctgatggacgagctgaccctcaccctcccgcgcaagatccgcgac
gagacccggcgcgcgatcgaggaggcgggcggcacctggcccgcacaccccgccgacgcg
gtcgtcgaccggatggtcgacgagttcgggcggcccggacgcagtgggggagcgggcttc
tacgagtacggcgaggacggccggcggggcctgctgtggccggggctgcgcgagcacttc
acccggcccggcgccgagatcccgttcgaggacatgcaggagcggatgctcttctccgag
gcgctggacagcgtccgctgtctggaggagaacgtcctgacgaccgtcgccgacgccaac
atcggctcgatcatggggatcggcttcccgccctggaccggcggcgtactccagtacatc
aacggctacgagggcggcctgcccggcttcgtggcccgcgcccggcagctcgccgagcgc
tacggcgaccgcttcctgccgtcgccgctgctgctggagaaggcggagaagggcgagacc
ttccacgactga

KEGG   Streptomyces sp. SirexAA-E: SACTE_6447
Entry
SACTE_6447        CDS       T01601                                 

Definition
(GenBank) Enoyl-CoA hydratase/isomerase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
ssx  Streptomyces sp. SirexAA-E
Pathway
ssx00071  Fatty acid degradation
ssx00280  Valine, leucine and isoleucine degradation
ssx00281  Geraniol degradation
ssx00310  Lysine degradation
ssx00360  Phenylalanine metabolism
ssx00362  Benzoate degradation
ssx00380  Tryptophan metabolism
ssx00410  beta-Alanine metabolism
ssx00627  Aminobenzoate degradation
ssx00640  Propanoate metabolism
ssx00650  Butanoate metabolism
ssx00903  Limonene and pinene degradation
ssx00930  Caprolactam degradation
ssx01100  Metabolic pathways
ssx01110  Biosynthesis of secondary metabolites
ssx01120  Microbial metabolism in diverse environments
ssx01212  Fatty acid metabolism
Module
ssx_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:ssx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    SACTE_6447
   00650 Butanoate metabolism
    SACTE_6447
  09103 Lipid metabolism
   00071 Fatty acid degradation
    SACTE_6447
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SACTE_6447
   00310 Lysine degradation
    SACTE_6447
   00360 Phenylalanine metabolism
    SACTE_6447
   00380 Tryptophan metabolism
    SACTE_6447
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    SACTE_6447
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    SACTE_6447
   00281 Geraniol degradation
    SACTE_6447
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    SACTE_6447
   00627 Aminobenzoate degradation
    SACTE_6447
   00930 Caprolactam degradation
    SACTE_6447
Enzymes [BR:ssx01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     SACTE_6447
SSDB
Motif
Pfam: ECH_2 ECH_1
Other DBs
NCBI-ProteinID: AEN14215
UniProt: G2NK33
Position
7299417..7300481
AA seq 354 aa
MNDDESVLLHTEGHTLHITLNRPRALNALTHTMVRSIDEALTQAEADASVVAVVISGAGE
RGLCAGGDIRSIYQDARAGRRASVDFWRDEYLLNARIARFPKPYVALMDGIVMGGGVGVS
AHGDVRVVTERSRVAMPETGIGFVPDVGGTHLLGAAPGELGTHLALTGRPVNAADALACG
LADHFVPSARLSDLVEALSRCTAPADVPETVRRYGGTAPAPELAEHRAWIDDCYAADTVE
EIIDRLAHTGLPAAEETARSLRTLSPTSLKVTLEAVRRARRLGGLEAALDQEFRVSCRAF
EGHDLVEGVRARIIDKDRAPKWNPAQLGDVTEADVARHFEPLGAGELGLHAAAS
NT seq 1065 nt   +upstreamnt  +downstreamnt
atgaacgacgacgagtccgtcctgctgcacaccgagggccacaccctgcacatcaccctc
aaccgccccagggcactgaacgccctcacccacaccatggtccggagcatcgacgaggcc
ctcacccaggccgaggccgacgcctcggtcgtcgccgtcgtgatcagcggcgccggcgaa
cgaggactctgcgcgggaggcgacatccgctcgatctaccaggacgcccgtgcgggccgg
cgcgcctccgtggacttctggcgcgacgagtacctgctgaacgcgcggatcgcccggttc
cccaagccgtacgtggcgctcatggacggcatcgtgatgggcggcggcgtcggcgtctcg
gcccacggtgacgtccgcgtcgtcaccgaacgctcccgcgtcgccatgcccgagaccggc
atcggcttcgtccccgacgtcggcggcacccatctgctcggcgccgcgcccggggagctc
ggtacccacctcgccctcaccggcaggccggtgaacgccgccgacgccctcgcgtgcggg
ctcgccgaccacttcgtcccctccgcccggctgtccgacctcgtcgaggcgctctcccgg
tgcaccgcacccgcggatgtgccggagacggtccggcggtacgggggtacggcacccgcc
ccggaactcgcggagcaccgcgcgtggatcgacgactgctacgccgcggacacggtcgag
gagatcatcgaccggctcgcacacaccgggttgccggcggccgaggagaccgcgcgctca
ctccggaccctgtcacccacctcgctcaaggtcaccctcgaagccgtgcgccgggcccgg
cggctcggagggctggaagcggcactggaccaggagttccgcgtctcctgccgcgccttc
gagggccacgacctggtggaaggggtgcgggcccgcatcatcgacaaggaccgtgccccc
aaatggaaccccgcgcagctcggtgacgtcaccgaggccgatgtcgcccgtcacttcgaa
ccgctcggagcgggagaactcggtctgcacgccgccgcctcctga

DBGET integrated database retrieval system