KEGG   Streptomyces sp. SirexAA-E: SACTE_4484Help
Entry
SACTE_4484        CDS       T01601                                 

Definition
(GenBank) Polyprenyl synthetase
  KO
K13787  geranylgeranyl diphosphate synthase, type I [EC:2.5.1.1 2.5.1.10 2.5.1.29]
Organism
ssx  Streptomyces sp. SirexAA-E
Pathway
ssx00900  Terpenoid backbone biosynthesis
ssx01100  Metabolic pathways
ssx01110  Biosynthesis of secondary metabolites
ssx01130  Biosynthesis of antibiotics
Module
ssx_M00364  C10-C20 isoprenoid biosynthesis, bacteria
Brite
KEGG Orthology (KO) [BR:ssx00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    SACTE_4484
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01006 Prenyltransferases [BR:ssx01006]
    SACTE_4484
Enzymes [BR:ssx01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.1  dimethylallyltranstransferase
     SACTE_4484
    2.5.1.10  (2E,6E)-farnesyl diphosphate synthase
     SACTE_4484
    2.5.1.29  geranylgeranyl diphosphate synthase
     SACTE_4484
Prenyltransferases [BR:ssx01006]
 Terpene biosynthesis
  Prenyl diphosphate synthase
   SACTE_4484
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: polyprenyl_synt
Motif
Other DBs
NCBI-ProteinID: AEN12314
UniProt: G2NM37
Position
4957655..4958704
Genome map
AA seq 349 aa AA seqDB search
MTMTSTDAATEGQEAAVLLERTRGLVDPHLRAAVDTLPGAIRRVARYHFGWQNADGTPAS
GQAGKAIRPALVLAAARALGGDPESALRAAVAVELVHNFTLLHDDVIDEDATRRHRPTAW
AVFGVPDAVVTGDAVLALAQRLLAEDPHPGSARASARLSACVIELCAGQQADCALEEREP
LDVTLDECLTMATAKTGALLGCACALGALYAGADEPAVEAMDGFGREAGLAFQLIDDLIG
IWGDTARTGKPVGADLAAHKKSLPVVAALTSGTPAADELAVLYRGAMNTPAEVSGAAAAV
DRAGGRDWAQACAADRMARAVHHLSRAVPDPAAAQDLLALAEFVTRRTH
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
gtgaccatgacgagtacggacgccgcgacggagggacaggaggccgcagtactcctggag
cgcacccgcggcctcgtggacccgcacctcagggcggcggtggacacgctgcccggggcg
atacggcgggtcgcccggtaccacttcggttggcagaacgccgacgggacacccgcatcc
gggcaggcgggcaaggccatcaggcccgcgctcgtgctggccgccgcccgcgcgctgggc
ggcgatccggagtcggccctgcgggccgccgtcgccgtggagctggtccacaacttcacc
ctgctccacgacgacgtcatcgacgaggacgcgacccggcggcaccgtcccacggcatgg
gcggtgttcggcgtcccggacgcggtcgtcaccggtgacgccgtgctcgcgctcgcccag
cggctgctggccgaggacccgcaccccgggtccgcccgtgcctcggcgcggctctccgcc
tgcgtcatcgaactgtgtgccggacagcaggccgactgcgcgctggaggagcgcgaaccc
ctcgacgtcaccctcgacgagtgcctcacgatggcgacggccaagacgggcgccctgctc
ggctgcgcctgcgccctcggagcgctctacgcgggggcggacgagccggccgtcgaggcc
atggacggcttcggcagggaggcgggcctcgccttccagctcatcgacgacctgatcggc
atctggggcgacaccgcccgcacgggcaaaccggtcggcgctgatctcgccgcccacaag
aagtccctcccggtggtggccgccctcacctcgggcacgcccgccgccgacgagctcgcc
gtgctctaccgcggggccatgaacacccccgccgaggtgtccggggcggcggcagcggtc
gaccgggccggcggccgcgactgggcccaggcctgtgcggcggaccggatggcgcgcgcc
gtgcaccacctctcccgcgcggtgcctgatccggcggccgcgcaggatctgctggcactg
gcggagttcgtgacccgcaggacgcactga

DBGET integrated database retrieval system