KEGG   Streptomyces sp. SirexAA-E: SACTE_5255
Entry
SACTE_5255        CDS       T01601                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00632  acetyl-CoA acyltransferase [EC:2.3.1.16]
Organism
ssx  Streptomyces sp. SirexAA-E
Pathway
ssx00071  Fatty acid degradation
ssx00280  Valine, leucine and isoleucine degradation
ssx00281  Geraniol degradation
ssx00362  Benzoate degradation
ssx00592  alpha-Linolenic acid metabolism
ssx01100  Metabolic pathways
ssx01110  Biosynthesis of secondary metabolites
ssx01120  Microbial metabolism in diverse environments
ssx01212  Fatty acid metabolism
Module
ssx_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:ssx00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    SACTE_5255
   00592 alpha-Linolenic acid metabolism
    SACTE_5255
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SACTE_5255
  09109 Metabolism of terpenoids and polyketides
   00281 Geraniol degradation
    SACTE_5255
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    SACTE_5255
   00642 Ethylbenzene degradation
    SACTE_5255
Enzymes [BR:ssx01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.16  acetyl-CoA C-acyltransferase
     SACTE_5255
SSDB
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C
Other DBs
NCBI-ProteinID: AEN13071
UniProt: G2NMJ0
Position
complement(5945566..5946786)
AA seq 406 aa
MPRTIRDVVFVDGVRTPFGKAGPKGIYHETRADDLVVKAIRELLRRNPDLDPAKIDEVAV
AATTQIGDQGLTLGRTAGILAGLPQSVPGYSIDRMCAGALTAVTSTAGSIAFGAYDVVVA
GGVEHMGRHPMGEGVDPNPRFVSEKLVDESALFMGMTAENLHDRYPSITKQRADEYAVRS
QEKAAKAYADGKIQQDLVPVAVRRTNAEGGETGWGLVTADEPMRPGTTLENLAGLKTPFR
AHGRVTAGNAAGLNDGATASLLAAEDVARELGLPVKMRLVSYAFAGVEPEVMGYGPIPAT
EKALAKAGLSIDDIGLFEINEAFAVQVLAFLEHYGIADDDARVNQYGGAIAYGHPLASSG
VRLMTQLARQFEEHPEVHYGLTTMCVGFGMGATVVWENPNFDGGTK
NT seq 1221 nt   +upstreamnt  +downstreamnt
gtgcctcgtaccatccgggacgtcgtcttcgtcgacggcgtccgcaccccgttcggcaaa
gcgggcccgaagggcatctaccacgagacccgcgccgacgatctcgtcgtgaaggccatc
cgggagctgctgcgccgcaacccggacctggaccccgcgaagatcgacgaggtcgccgtc
gccgcgaccacccagatcggtgaccagggtctgacgctgggccgtaccgccgggatcctg
gccggtctgccgcagtcggtcccgggctactccatcgaccgcatgtgcgccggtgcgctg
accgccgtcacgtcgacggccggttccatcgccttcggcgcgtacgacgtcgtcgtcgcc
ggtggcgtcgagcacatgggccgccacccgatgggcgagggcgtggacccgaacccgcgc
ttcgtctcggagaagctggtcgacgagtccgccctcttcatgggcatgaccgcggagaac
ctgcacgaccggtacccctcgatcaccaagcagcgcgccgacgagtacgcggtccgctcg
caggagaaggccgccaaggcgtacgccgacggcaagatccagcaggacctggtgccggtc
gcggtgcgccgcaccaacgccgagggcggcgagacgggctggggcctggtcaccgccgac
gagccgatgcgtccgggcaccacgctggagaacctggccggcctgaagaccccgttccgc
gcccacggccgggtcaccgccggcaacgcggccgggctgaacgacggcgccaccgcctcg
ctgctcgccgccgaggacgtcgcccgcgagctgggcctcccggtcaagatgcgcctggtc
tcctacgccttcgcgggcgtcgagcccgaggtcatgggctacggcccgatcccggcgacg
gagaaggcgctggccaaggccggcctctccatcgacgacatcggcctcttcgagatcaac
gaggcgttcgccgtccaggtgctcgccttcctggagcactacggcatcgccgacgacgac
gcgcgcgtcaaccagtacggcggcgcgatcgcgtacggccaccctctggcctcctccggc
gtccgcctcatgactcagctggcccgccagttcgaggagcaccccgaggtccactacggc
ctgacgaccatgtgcgtcggcttcggcatgggcgcgacggtcgtctgggagaacccgaac
ttcgacggaggcaccaagtga

DBGET integrated database retrieval system