KEGG   Streptomyces sp. SirexAA-E: SACTE_5438Help
Entry
SACTE_5438        CDS       T01601                                 

Definition
(GenBank) AMP-dependent synthetase and ligase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
ssx  Streptomyces sp. SirexAA-E
Pathway
ssx00010  Glycolysis / Gluconeogenesis
ssx00620  Pyruvate metabolism
ssx00640  Propanoate metabolism
ssx00680  Methane metabolism
ssx01100  Metabolic pathways
ssx01110  Biosynthesis of secondary metabolites
ssx01120  Microbial metabolism in diverse environments
ssx01130  Biosynthesis of antibiotics
ssx01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ssx00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SACTE_5438
   00620 Pyruvate metabolism
    SACTE_5438
   00640 Propanoate metabolism
    SACTE_5438
  Energy metabolism
   00680 Methane metabolism
    SACTE_5438
Enzymes [BR:ssx01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     SACTE_5438
Lipid biosynthesis proteins [BR:ssx01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   SACTE_5438
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: AEN13247
UniProt: G2NRA5
Position
6147942..6149618
Genome map
AA seq 558 aa AA seqDB search
MPATSATQTFREARDFLLEHREDYATAYAGFRWPRPPHFNWALDWFDVIAEGNDRTALHI
VEEDGGRTEVSFAAMAARSDRAANWMRSQGVAAGDRILVMLGNQTELWETALAAMKLRAV
VIPATPLLGPVDLRDRVERGRIRHVLVRSEDTAKFDEVPGDYTRIAVGEDVDGWLAYRGA
EEAADTFTPTRETDADEALMLYFTSGTTASPKLVEHTHVSYPVGHLSTMYWIGLKPGDVH
LNISSPGWAKHAWSNLFAPWSAEATVFVFNYTRFDAARLMAEMDRSSVTSFCAPPTVWRM
LIQADLSQLRTPPREVVAAGEPLNPEVIETVRRAWGVTIRDGFGQTETAVQVANTPGQPL
KAGSMGRPNPGFRVELLDPVTGAPGAAEGEISLDLSDAPVGLMTGYHGDPERTARAMAGG
YYRTGDIGSRDEDGYITYVGRADDVFKASDYKISPFELESALLEHEAVAEAAVVPAPDPV
RLAVPKAYVVLAEGWEPGPDTAKVLFAHSRSVLAPYKRIRKLEFADLPKTVSGKIRRIEL
REATARGTGAEFDEGDLR
NT seq 1677 nt NT seq  +upstreamnt  +downstreamnt
atgccggcaaccagcgcgacgcagacgttccgggaggcacgggacttcctgctggagcac
cgcgaggactacgcgacggcctacgcgggcttccgctggccccggccaccccatttcaac
tgggcgctcgactggttcgacgtcatcgccgagggcaacgaccgcaccgccctgcacatc
gtcgaggaggacggcggccgcaccgaggtgtccttcgccgcgatggcagcccggtccgac
cgggcggcgaactggatgcggtcccaaggcgtcgcggccggcgaccggatcctcgtcatg
ctcggcaaccagaccgaactgtgggagaccgccctcgcggcgatgaagctgcgcgccgtc
gtcatccccgccaccccgctgctgggccccgtcgacctgcgcgaccgcgtcgaacgcggc
cggatccggcacgtcctcgtacggtccgaggacaccgcgaagttcgacgaggtgcccggc
gactacacccggatcgcggtcggtgaggacgtcgacggctggctcgcctaccgcggggcc
gaggaggccgccgacaccttcacgccgacccgggagaccgacgccgacgaggcgctgatg
ctctacttcacctccgggacgaccgccagccccaagctcgtcgaacacacccatgtgtcc
tacccggtcggtcacctgtcgacgatgtactggatcgggctgaagcccggtgacgtccac
ctgaacatctcctcgcccggctgggccaagcacgcctggtccaacctcttcgccccgtgg
agcgccgaggccaccgtcttcgtcttcaactacacccgcttcgacgcggcccggctgatg
gcggagatggaccgctcgtcggtcaccagcttctgcgcccctccgaccgtgtggcgcatg
ctcatccaggccgacctgtcgcagctgaggacgcccccgcgtgaggtcgtcgccgcgggt
gaacccctcaaccccgaggtcatcgagaccgtccggcgggcctggggcgtcaccatccgg
gacggcttcggacagaccgagaccgccgtccaggtcgccaacaccccggggcagccgttg
aaggcgggctcgatgggccgccccaaccccggcttcagggtggaactgctggacccggtg
accggtgcgccgggcgcggcggagggcgagatctccctggacctgtccgacgcccccgtc
ggcctgatgacgggctaccacggcgacccggagcgcaccgcccgggctatggcaggcggc
tactaccgcaccggcgacatcggctcccgggacgaggacggctacatcacctatgtcggc
cgggccgacgacgtgttcaaggcctccgactacaagatctcgcccttcgagctggagagc
gccctgctggagcacgaggcggtcgccgaggcggcggtcgtgcccgccccggacccggtg
cggctcgccgtgccgaaggcgtacgtggtgctggcggagggctgggagccggggccggac
accgcgaaggtgctgttcgcgcactcccggtcggtcctcgccccctacaagcgcatccgc
aaactggagttcgccgacctgcccaagaccgtctccgggaagatccgccggatcgagctg
cgcgaggcgaccgcccggggcaccggtgccgagttcgacgagggggacctgcgatga

DBGET integrated database retrieval system