KEGG   Streptomyces sp. SirexAA-E: SACTE_5619Help
Entry
SACTE_5619        CDS       T01601                                 

Definition
(GenBank) isocitrate dehydrogenase, NADP-dependent
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
ssx  Streptomyces sp. SirexAA-E
Pathway
ssx00020  Citrate cycle (TCA cycle)
ssx00480  Glutathione metabolism
ssx01100  Metabolic pathways
ssx01110  Biosynthesis of secondary metabolites
ssx01120  Microbial metabolism in diverse environments
ssx01130  Biosynthesis of antibiotics
ssx01200  Carbon metabolism
ssx01210  2-Oxocarboxylic acid metabolism
ssx01230  Biosynthesis of amino acids
Module
ssx_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ssx_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:ssx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SACTE_5619
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    SACTE_5619
Enzymes [BR:ssx01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     SACTE_5619
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IDH
Motif
Other DBs
NCBI-ProteinID: AEN13410
UniProt: G2NMP0
Position
6375629..6377848
Genome map
AA seq 739 aa AA seqDB search
MTDSTIIYTHTDEAPALATYSFLPVVEAYASTAGVTVESRDISLAGRIIASFPERLKADQ
RIDDALAELGELAKAPGANIIKLPNISASIPQLKAAIAELQEQGYALPDYPDDPKTDEDK
DVRARYDKVKGSAVNPVLREGNSDRRAPASVKNYAKTHPHRMGAWTADSKTNVATMGVDD
FRSTEKSAVVTEPGNLRIELVGDDGTTTVLRESVPVLAGEVVDAAVLRVAALREFITAQI
ARAKAEGVLFSVHLKATMMKVSDPIIFGHVVRAFFPKTFAAYGDVLAAAGLTPNDGLGGI
LKGLESLPEGAKIKESFEAELAEGPALAMVDSDKGITNLHVPSDVIVDASMPAMIRTSGH
MWGPDGDEADTIAVLPDSSYAGVYQVVIDDCRANGAFDPSTMGSVPNVGLMAQKAEEYGS
HDKTFEIPATGTVRVVDAAGNAVLEQAVGAGDIFRMCQTKDLPIQDWVKLAVTRARATGN
PAVFWLDEDRAHDAKLIEKVKTYLADHDTDGLQIEIMTPEKATAFSLERIRRGEDTISVT
GNVLRDYLTDLFPILELGTSAKMLSVVPLMNGGGLFETGAGGSAPKHVQQLVKEDYLRWD
SLGEFLALAVSFEHLAQTTGNARAQVLADTLDRATATFLNEDKSPSRRLGGIDNRGSHFY
LALYWAQELARQTEDAKLAEAFAALAKTLAEQEQTIVDELVAVQGKPADIGGYYQPDPAK
AAAVMRPSATFNAAVASLS
NT seq 2220 nt NT seq  +upstreamnt  +downstreamnt
gtgactgactcgaccatcatctatacgcacaccgacgaggcccctgccctggcgacgtac
tcgttcctgcccgtcgtcgaggcgtacgcctcgaccgcgggggtcacggtggagagccgt
gacatctcgctggccggacgcatcatcgccagtttcccggagcgtctgaaggccgaccag
cgtatcgatgacgcactcgccgagctcggcgagctggccaaggctcccggcgccaacatc
atcaagctgccgaacatctcggcgtccatcccgcagctgaaggccgcgatcgccgagctg
caggagcagggctacgcgcttccggactacccggacgacccgaagaccgacgaggacaag
gacgtccgcgcgcgttacgacaaggtcaagggcagcgccgtcaacccggtcctgcgcgag
ggcaactccgaccgccgcgcccccgcgtcggtcaagaactacgccaagacgcacccgcac
cgcatgggcgcctggaccgccgactccaagacgaacgtcgccaccatgggcgtcgacgac
ttccggtccaccgagaagtccgccgtcgtcacggagccgggcaacctgcgcatcgagctc
gtcggtgacgacggcaccaccaccgtcctgcgcgagtccgtccccgtcctggccggcgag
gtcgtcgacgccgccgtgctgcgcgtcgccgcgctgcgcgagttcatcaccgcccagatc
gcccgcgccaaggccgagggcgtgctgttctcggtgcacctcaaggccacgatgatgaag
gtctccgacccgatcatcttcggccacgtggtgcgcgccttcttcccgaagaccttcgcc
gcgtacggtgacgtgctcgccgcggccggcctcaccccgaacgacgggctcggcggcatc
ctcaagggcctggagtcgctgcccgagggcgcgaagatcaaggagtccttcgaggccgag
ctcgccgagggcccggccctggcgatggtcgactccgacaagggcatcaccaacctgcac
gtccccagcgacgtcatcgtggacgcctcgatgcccgccatgatccgcacctccggccac
atgtggggcccggacggcgacgaggcggacaccatcgccgtgctgccggacagcagctac
gcgggcgtctaccaggtcgtgatcgacgactgccgtgccaacggagccttcgacccgtcc
acgatgggctcggtgcccaacgtcggtctcatggcgcagaaggccgaggagtacggcagc
cacgacaagaccttcgagatccccgccacgggcacggtgcgcgtcgtcgacgccgccggc
aacgccgtgctggagcaggccgtcggcgccggtgacatcttccggatgtgccagaccaag
gacctgccgatccaggactgggtcaagctcgccgtcacccgcgcccgtgcgaccggcaac
ccggccgtcttctggctcgacgaggaccgcgcgcacgacgcgaagctcatcgagaaggtc
aagacgtacctggccgaccacgacaccgacggtctgcagatcgagatcatgaccccggag
aaggccaccgccttctccctggagcgcatccgccgcggtgaggacaccatctccgtcacc
ggcaacgtgctccgtgactacctcacggacctgttcccgatcctggagctcggcaccagc
gcgaagatgctctccgtcgtcccgctgatgaacggcggcggcctcttcgagacgggcgcc
ggcggctccgcgccgaagcacgtgcagcagctcgtcaaggaggactacctgcgctgggac
agcctgggtgagttcctcgccctcgccgtcagtttcgagcacctcgcgcagaccacgggc
aatgcccgcgcccaggtcctcgccgacacgctggaccgcgccacggccacgttcctcaac
gaggacaagtcgcccagccgtcggctcggcggcatcgacaaccgcggcagccacttctac
ctggccctgtactgggcgcaggagctggcccggcagaccgaggacgccaagctcgccgag
gcgttcgcggcgctcgccaagacgctggccgagcaggagcagaccatcgtcgacgagctc
gtcgcggtccagggcaagccggccgacatcggcggctactaccagcccgacccggcgaag
gccgcggcggtcatgcgcccgtcggccacgttcaacgcggccgtcgcctcgctgagctga

DBGET integrated database retrieval system