KEGG   Streptomyces sp. SirexAA-E: SACTE_6099Help
Entry
SACTE_6099        CDS       T01601                                 

Definition
(GenBank) Alcohol dehydrogenase GroES domain protein
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
ssx  Streptomyces sp. SirexAA-E
Pathway
ssx00010  Glycolysis / Gluconeogenesis
ssx00071  Fatty acid degradation
ssx00350  Tyrosine metabolism
ssx00625  Chloroalkane and chloroalkene degradation
ssx00626  Naphthalene degradation
ssx01100  Metabolic pathways
ssx01110  Biosynthesis of secondary metabolites
ssx01120  Microbial metabolism in diverse environments
ssx01130  Biosynthesis of antibiotics
ssx01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:ssx00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SACTE_6099
  Lipid metabolism
   00071 Fatty acid degradation
    SACTE_6099
  Amino acid metabolism
   00350 Tyrosine metabolism
    SACTE_6099
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    SACTE_6099
   00626 Naphthalene degradation
    SACTE_6099
Enzymes [BR:ssx01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     SACTE_6099
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 Sacchrp_dh_NADP AlaDh_PNT_C 2-Hacid_dh_C Methyltransf_25 Glu_dehyd_C TrkA_N
Motif
Other DBs
NCBI-ProteinID: AEN13878
UniProt: G2NQA3
Position
6934376..6935416
Genome map
AA seq 346 aa AA seqDB search
MKAVQYRTVGAAPEVVDIPEPVPGPGQILLKVSAAGVCHSDIAVMSWPAEGFPYELPLTL
GHEGVGTVAALGDGAHGFAVGDSVAVYGPWGCGTCVNCADGRENYCLRAADLGINPPGLG
SPGAMAEYMIVDDARHLVPIGDLDPVKTVSLTDAGLTPYHAIKRSLPKLVPGATAVVIGT
GGLGHVAIQLLRAMTSVRVIALDVSEEKLALARSVGAHDTVISDENAAAEVRELTGGIGA
QVVLDFVGAPPTVKTAGASASVDSDVTIVGIGGGTLPVGFGVLPFSTSVSAPYWGTRREL
AEVIELAHAGAVDVHVETYSIDEAPLAYERLHDGKINGRAVILPNG
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgaaagccgtccagtaccgcaccgtcggcgccgcccccgaggtcgtcgacataccggag
cccgtaccgggcccggggcagatcctgctgaaggtcagcgccgccggtgtctgccactcg
gacatcgccgtgatgagctggcccgccgaaggattcccctacgagctgccgctgacgctc
ggacacgagggcgtcggcaccgtcgccgcgctcggtgacggcgcccacggcttcgcggtg
ggcgactccgtcgcggtctacggcccctggggctgcggcacctgcgtgaactgcgcggac
ggccgggagaactactgcctgcgcgccgccgacctcggcatcaacccgccgggtctgggc
agtccgggtgccatggccgagtacatgatcgtcgacgatgcccgccatctggtcccgatc
ggcgacctggaccccgtcaagacggtctcgctgaccgacgcgggcctcacgccgtaccac
gccatcaagcgctccctgcccaagctggtgcccggcgccacagccgtggtcatcggcacc
ggggggctcgggcacgtggccatccagctgctccgcgccatgacctccgtccgcgtcatc
gcgctcgacgtctccgaggagaagctggccctcgcccggtccgtcggcgcccacgacacg
gtgatctccgacgagaacgcggccgccgaggtccgcgagctcaccggaggcatcggagcc
caggtcgtcctcgacttcgtcggagccccgccgaccgtgaagacggccggtgcgtccgcc
tctgtcgacagcgacgtcaccatcgtcggcatcggtggcggaacgctccccgtcgggttc
ggcgtcctgccgttctcgacatcggtctccgcaccgtactggggcacccgccgggagctc
gccgaagtgatcgaactcgctcacgccggtgccgtcgacgtccacgtcgagacgtactcg
atcgacgaggcccccctcgcctacgaacggctgcacgacggcaagatcaacggccgcgcc
gtcatcctgcccaacggctga

DBGET integrated database retrieval system