KEGG   Sphingobium sp. SYK-6: SLG_00740Help
Entry
SLG_00740         CDS       T01622                                 

Gene name
sucB
Definition
(GenBank) 2-oxoglutarate dehydrogenase E2 component
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
ssy  Sphingobium sp. SYK-6
Pathway
ssy00020  Citrate cycle (TCA cycle)
ssy00310  Lysine degradation
ssy01100  Metabolic pathways
ssy01110  Biosynthesis of secondary metabolites
ssy01120  Microbial metabolism in diverse environments
ssy01130  Biosynthesis of antibiotics
ssy01200  Carbon metabolism
Module
ssy_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ssy_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:ssy00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SLG_00740 (sucB)
  Amino acid metabolism
   00310 Lysine degradation
    SLG_00740 (sucB)
Enzymes [BR:ssy01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     SLG_00740 (sucB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H HlyD_3 SAPS HlyD_D23 EKR
Motif
Other DBs
NCBI-ProteinID: BAK64749
NITE: SLG_00740
UniProt: G2IIR9
Position
71393..72667
Genome map
AA seq 424 aa AA seqDB search
MATEVKVPTLGESVTEATVGQWLKKPGEAVKADEPIASLETDKVAIEVPSPVSGVLGELL
VKEGDTVNVGAVIATIEDGGAPAAKAASAAPAPAKAEAAPAPAATPAPAAPAPAAAPAAE
SESASGPITLSPAVRRLVLEHGLDPSRITGTGKDGRLTKDDVLAAIAAGTAVAAAPAGAS
PAAAAAPASGPSREQERVKMTRLRQTVARRLKEAQNNAAILTTFNDVDMTAVIEARAKYK
DLFEKKHGIRLGFMGFFVKAACMALKDIPGVNAQIEGDEIVYNNFCDISVAVSAPNGLMV
PVIRNAESMSIAEIEKTIADFGKRAKEGSLSMADMAGGTFTISNGGVFGSLLSTPIINPP
QSGVLGLHRIEERPVVRNGQIVARPMMYLALSYDHRLIDGREAVTFLVAMKNAIEDPTRL
LIDL
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atggccaccgaagtgaaagtgcccacgctgggcgaatcggtcaccgaggcgaccgtcggc
cagtggctgaagaagcccggcgaagccgtgaaggccgacgaaccgatcgcgagcctggaa
acggacaaggtcgccatcgaggtgccttcgcccgtgagcggcgtgctcggtgaactgctc
gtcaaggaaggcgacaccgtgaatgtcggcgcggtcatcgcgacgatcgaggacggcggg
gccccggcggccaaggccgccagcgcagcgccggccccggcgaaggccgaagcagcgcct
gcgcctgcagcaacgcctgcgcccgcagcaccggcacccgccgccgcccccgcggcggaa
tccgagagcgcatccgggccgatcacgctgtcgcccgccgtgcgccgtctcgtcctcgag
catggcctcgaccccagccggatcaccggcaccggcaaggatggccgcctgaccaaggat
gacgtgctcgcggccatcgccgccggcaccgccgtcgcggctgcccccgcgggcgccagc
ccggccgcggccgctgcgccggcctccggtccttcccgcgagcaggagcgcgtgaagatg
acgcgcctgcgccagaccgtcgcccggcgactgaaggaagcgcagaacaacgccgccatt
ctcacgaccttcaacgatgtcgacatgaccgccgtcatcgaggcgcgcgcgaagtacaag
gacctgttcgagaagaagcacggcatccgcctcggcttcatgggcttcttcgtgaaggcc
gcgtgcatggcgctcaaggacattccgggcgtcaacgcgcagatcgagggcgacgagatc
gtctacaataatttctgcgacatctcggtcgcggtttccgcgcccaatggcctcatggtg
ccggtgatccgcaatgccgagagcatgagcatcgcggagatcgaaaagacgatcgccgat
ttcggcaagcgcgccaaggaaggctcgctttccatggcggacatggccggcggcactttc
accatctccaatggcggcgtgttcggcagcctgctgtccacgcccatcatcaatccgccc
cagtccggcgtgctcggcctgcaccgcatcgaggagcgcccggtcgtcaggaacggccag
atcgtggcgcggccgatgatgtatctggcgctgagctacgaccatcgcctgattgacggg
cgcgaggccgtgaccttccttgtcgcgatgaagaatgcgatcgaggatcccacccggctg
ctgatcgacttgtaa

DBGET integrated database retrieval system