KEGG   Sphingobium sp. SYK-6: SLG_01040Help
Entry
SLG_01040         CDS       T01622                                 

Gene name
proB
Definition
(GenBank) glutamate 5-kinase
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Organism
ssy  Sphingobium sp. SYK-6
Pathway
ssy00330  Arginine and proline metabolism
ssy00332  Carbapenem biosynthesis
ssy01100  Metabolic pathways
ssy01130  Biosynthesis of antibiotics
ssy01230  Biosynthesis of amino acids
Module
ssy_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:ssy00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    SLG_01040 (proB)
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    SLG_01040 (proB)
Enzymes [BR:ssy01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     SLG_01040 (proB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase PUA TruB_C
Motif
Other DBs
NCBI-ProteinID: BAK64779
NITE: SLG_01040
UniProt: G2IJA9
Position
101413..102603
Genome map
AA seq 396 aa AA seqDB search
MVADLTGAARATAPQVEARAPTDDLTGFPPGILRRVVIKVGSALLVEPDGAVRRKWLESL
VGEIAQRRAEGQQIVVVSSGAIALGARRLGLSRGGRATLEDAQAAAAVGQIILSQVWADL
LASHDIAAAQMLVTLGDLEDRRRYLNAAATLDRLIGLGVVPVVNENDSVATEEIRFGDND
RLAARIGQAARADAVVLLSDIDGLYTANPQADPEATLIPLVEKIDARILAMADGNSASGM
GSGGMISKLQAARIATGAGTHLAIASGRVESPLRHWAETGMGTLFRAAARRRGRKDWLAG
RLTVKGRLSVDAGAADALRQGRSLLPAGVTGTSGAYARGDVIDIADPDGAVIARGLAQYD
SQDAERIIGKRSEDVAALLGGTPRAAMVHRDHMVLL
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
ttggtcgccgatctgacgggggcggcgcgcgcgacggcgccgcaggtggaggccagagcc
ccgactgacgatcttaccggcttcccgcccggcattctccgccgcgtggtcatcaaggtg
ggatcagccctgctcgtagagcccgatggcgcggtgcgtcgcaaatggctggagagcctc
gttggcgagatcgcgcagcggcgcgccgaggggcagcagatcgtcgtcgtctcgtccggt
gcgatcgcgctcggtgcccggcggctgggactctcccggggcgggcgggccacgctggag
gacgcgcaggcggcggccgctgtggggcagatcatcctcagccaggtctgggccgatctt
ctggcaagccacgacatcgcggccgcgcagatgctggtcacgcttggcgatctcgaggac
cggcggcgctatctcaacgccgcagcgacgctggaccggctgatcggcctcggcgtcgtg
ccggtggtcaacgagaatgacagcgtggccaccgaggagatccgcttcggagacaatgac
aggctcgccgcgcgcatcgggcaggctgcccgcgcggacgcggtggtcctcctctcggat
atcgacgggctgtataccgccaatccgcaggccgatcccgaggcgacgctcatcccgctg
gtcgagaagatcgatgcgcgcatcctcgccatggcggacggcaactcggcctcgggcatg
ggctcgggcggcatgatctccaagctgcaggccgcccggatcgcgaccggcgccggaacg
cacctcgccattgcctccgggcgcgtcgagtcgcccctgaggcattgggcggagaccggc
atgggcacgctgttccgtgccgctgcccggcggcggggacgcaaggactggctggcgggg
cgccttacggtgaaggggcggctgagcgtggatgcgggcgctgccgatgccttgcggcag
gggcgcagcctgcttcccgccggcgtcaccgggacgagtggcgcctatgccagaggggac
gtcatcgacatcgcggacccggacggcgccgtgatcgcgcgggggctggcgcaatatgac
agtcaggacgccgagcgcatcatcggcaagcgcagcgaggatgtggcagccctgctgggc
ggcacgccgcgcgccgccatggtccatcgcgaccatatggtgctgctctga

DBGET integrated database retrieval system