KEGG   Sphingobium sp. SYK-6: SLG_05370Help
Entry
SLG_05370         CDS       T01622                                 

Gene name
gpm
Definition
(GenBank) phosphoglycerate mutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
ssy  Sphingobium sp. SYK-6
Pathway
ssy00010  Glycolysis / Gluconeogenesis
ssy00260  Glycine, serine and threonine metabolism
ssy00680  Methane metabolism
ssy01100  Metabolic pathways
ssy01110  Biosynthesis of secondary metabolites
ssy01120  Microbial metabolism in diverse environments
ssy01130  Biosynthesis of antibiotics
ssy01200  Carbon metabolism
ssy01230  Biosynthesis of amino acids
Module
ssy_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
ssy_M00002  Glycolysis, core module involving three-carbon compounds
ssy_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:ssy00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SLG_05370 (gpm)
  Energy metabolism
   00680 Methane metabolism
    SLG_05370 (gpm)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SLG_05370 (gpm)
Enzymes [BR:ssy01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     SLG_05370 (gpm)
Membrane trafficking [BR:ssy04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    SLG_05370 (gpm)
Exosome [BR:ssy04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   SLG_05370 (gpm)
  Exosomal proteins of melanoma cells
   SLG_05370 (gpm)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1 ANTAR
Motif
Other DBs
NCBI-ProteinID: BAK65212
NITE: SLG_05370
UniProt: G2ILE9
Position
558709..559395
Genome map
AA seq 228 aa AA seqDB search
MPTLVLIRHGQSAWNLENRFTGWWDVDVTEKGAAEATAAGALMKEKGLDFDQCFTSLQKR
AIKTLHLALEEMDRLWLPVEKDWRLNERHYGGLTGLDKAETAAKHGDAQVKIWRRSFDVP
PPPLEAGSEYDLSKDRRYAGIDIPATESLKDTIARVLPYWESRIAPELKAGKRVLISAHG
NSLRALVKHLSNIPDDEITGLEIPTGQPIVYDLADDLTALDRYYLSER
NT seq 687 nt NT seq  +upstreamnt  +downstreamnt
atgcccacgcttgtcctcatccgccatggccagtccgcctggaacctggagaaccgcttc
accggctggtgggatgtggacgtgacggagaagggcgcggcggaagcgacggcggcaggc
gcgctgatgaaggagaaggggctggatttcgaccagtgcttcacctcgctgcagaagcgg
gcgatcaagacgctccatctcgcgctggaggaaatggaccggctctggctgccggtggag
aaggactggcgcctcaacgagcggcattatggcggcctcaccgggctcgacaaggcggag
acggcggccaagcatggcgacgcgcaggtgaagatctggcgccgcagcttcgacgtgccg
ccgccgccgctggaagcgggcagcgaatatgatctctcgaaggaccggcgctatgcgggc
atcgacattcccgcgacggaaagcctcaaggataccatcgcgcgcgtgctgccttattgg
gagagccgcatcgcgccggagctgaaggcgggcaagcgcgtgctcatctccgcccacggc
aattcgctgcgcgcgctggtcaagcatctctccaacattcccgatgacgagatcaccggg
ctggagatccccaccggccagcccatcgtctatgatctcgcggacgatctcacggcgctc
gaccgttattatctctccgagcgctga

DBGET integrated database retrieval system